KEGG   Rattus norvegicus (rat): 500311
Entry
500311            CDS       T01003                                 

Gene name
Gdf3, RGD1564178
Definition
(RefSeq) growth differentiation factor 3
  KO
K22672  growth differentiation factor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    500311 (Gdf3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    500311 (Gdf3)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   500311 (Gdf3)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 500311
NCBI-ProteinID: NP_001103141
RGD: 1564178
Ensembl: ENSRNOG00000015331
UniProt: A2SY89
Position
4q42
AA seq 366 aa
MQPSQRLLTLGFLLLTLARGQTSEFQDYDFLQFLGLKKAPSPHRFQPVPRILRKIIRARE
TAAASGASQDLCYVKELGVRGNLLRLLPDQGFFLNTQKPSQDGSCLQKVLSFNLSAVKEK
GKLTMAQLILHLGPRSYHYLQLELVVAVSVVQDRGVWGRSHPKLGRLLVQKSVLGPQGSL
QFNLQGVVKDWNRHQLKNLDLYLEILVKEDRYSRVNAQLDNPCNQLMHSLHASLLVVTLN
LKHCHPSSRKKRAAIPIPKGLCRNLCHRHQLFVNFQDLGWHKWVIAPKGFMANYCHGDCP
FTMTTYLNSSNYAFMQALMHMADPRVPKAVCIPTKLSPISMLYQDNEKNVILRHYEDMVV
DECGCG
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgcaaccttcccaaaggcttctgactctcggcttccttctgttaaccctggcccggggc
cagacatccgagtttcaagactatgactttttgcaatttctgggcttaaagaaagcgcct
tcaccccacaggttccaacctgtgcctcgcatcttaaggaaaatcatacgggctcgagaa
accgctgcagccagcggggcctcgcaggacttatgctacgtgaaggagctgggcgtccgt
gggaacctgcttcggcttctcccagaccagggttttttccttaacacacagaaaccttcc
caagatggctcctgtctacagaaggtcctctcttttaacttgtctgccgtcaaagaaaag
ggaaagttgaccatggcccagctgattctacacttggggcccaggtcctaccattacctg
cagctggagctggtggtggctgtatctgtggttcaggatcgtggtgtgtgggggcgatcc
caccctaagctgggcaggttgctcgttcagaagtctgtcctgggacctcaaggttctctt
cagttcaacctgcagggtgtggttaaggattggaaccgccaccaactgaagaatttggac
ttatacttagagattctggtcaaagaggacagatactccagggtaaatgcccagcttgat
aacccctgtaaccagctgatgcactctcttcatgcctccctgctggtggtgaccctcaac
cttaaacactgtcacccttcttccagaaagaagagggcagccatccctattcccaagggt
ctttgtaggaacctctgccatcgtcaccaactgttcgtcaacttccaggacctgggttgg
cacaagtgggtcattgcccctaagggtttcatggcaaactactgtcatggagattgcccc
ttcacaatgaccacgtatttgaatagctccaattatgccttcatgcaggctctgatgcat
atggctgaccccagggtccccaaggctgtctgtatccccaccaagctgtctccaatctcc
atgctctatcaagataacgagaagaacgtcattctccgacattatgaagacatggtagtg
gatgagtgtgggtgtgggtag

DBGET integrated database retrieval system