KEGG   Rattus norvegicus (rat): 500368
Entry
500368            CDS       T01003                                 

Gene name
Far2, Mlstd1, RGD1565966
Definition
(RefSeq) fatty acyl CoA reductase 2
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    500368 (Far2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    500368 (Far2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     500368 (Far2)
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase Polysacc_synt_2 3Beta_HSD Semialdhyde_dh GDP_Man_Dehyd KR
Other DBs
NCBI-GeneID: 500368
NCBI-ProteinID: XP_001074438
RGD: 1565966
Ensembl: ENSRNOG00000001851
UniProt: D4A9Z0
Position
4q44
AA seq 515 aa
MSMIAAFYSNKSILITGATGFLGKVLMEKLFRTSPHLKVIYILVRPKSGQTLQERVFQIL
NSKLFERVKEVCPNVHEKIRPISADLNQRDFAISKEDMQELLSCTNIVFHCAATVRFDAH
LREAVQLNVTATQQLLLMASEMPKLEAFIHISTAFSNCNLSHIDEVIYPCPVEPRKIIDS
MEWLDDSIIEEITPKLIGDRPNTYTYTKALGEVVVQQESGNLNVAIVRPSIVGATWQEPF
PGWVDNLNGPSGLIIATGKGFLRSIKATPMAVADLIPVDTVVNLTIAVGWYTAVHRPKST
LIYHSTSGNLNPCNWYEMGLQVLATVEKIPFESAFRRPNADFTTNNFTTQYWNTVSHWAP
AIIYDFYLRLTGRKPRMLKLMNRLLKTISMLEYFINHSWEWSTNNTEMLLSELSPEDQRV
FNFDVRQLNWLEYIENYVLGVKKYLLKEDLAGIPKAKQHLKRLRNIHYLFNTALFLIIWR
LLIARSQMARNIWFFIVSFCYKFISYFRASSTLKV
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgtccatgatcgccgctttctacagcaacaagtctatcctcatcacaggggccacaggc
ttcctgggcaaggtgctcatggagaagttattccgtaccagcccccacttgaaagtcatt
tacatcctcgtgagacccaagtctggacagacactgcaggagagggttttccagatcctc
aacagtaagctgttcgagagagtcaaggaagtctgtccaaatgtgcacgagaagatcaga
cccatctctgcagacctcaaccagcgtgacttcgccatcagcaaggaagatatgcaagaa
cttctgtcctgcaccaacatcgtcttccactgtgcagccacagtgcgctttgatgcacat
ctgagagaagctgtgcagctgaacgtcaccgccacccagcagctcctgctcatggccagc
gagatgccaaagctggaagccttcatccacatctccactgccttttctaactgcaacctg
agccacatcgatgaggtcatctacccgtgccccgtggagccgagaaagatcattgactcc
atggagtggttagatgactctatcattgaagagatcactcccaagctaattggggaccgg
cccaatacctacacctacaccaaagccttgggagaggtagttgtgcagcaagagagcgga
aacttgaatgtggctatcgtcaggccatccatagtgggagcaacctggcaggagcctttc
ccgggttgggttgataatctaaatggacccagtggactcattattgcgactgggaaagga
tttcttcggtccataaaagcaacacccatggcagtggcagatctgattccagttgacaca
gttgttaacctcaccatagcagtaggatggtatactgccgttcatagacctaagtcaacg
ttaatctaccattccacatctggcaatctcaatccctgtaactggtacgaaatgggatta
caggtcttggcgaccgtcgaaaagatcccatttgagagtgctttcagaaggccaaatgct
gacttcaccaccaacaatttcactacccagtattggaacaccgtcagccactgggctccg
gccatcatctatgacttctatctgaggcttactggaaggaaacccaggatgctgaagctc
atgaaccggctgctaaaaaccatttccatgctggagtatttcatcaaccacagctgggaa
tggagcacaaacaacactgagatgcttctgtcagagctcagtcctgaagaccagagagta
ttcaactttgatgtgcgtcagttgaactggcttgaatacattgagaattatgttttgggg
gttaagaagtatctactgaaagaggatctggctggtatccccaaagcaaagcaacaccta
aaaaggctccggaatattcactacctcttcaacactgccctgtttcttatcatctggcgc
ctcctcattgcaaggtctcagatggctcggaacatctggttcttcattgtgagcttctgt
tacaagttcatctcctacttccgggcctccagcacactcaaggtctaa

DBGET integrated database retrieval system