KEGG   Rattus norvegicus (rat): 500377Help
Entry
500377            CDS       T01003                                 

Gene name
Tuba8
Definition
(RefSeq) tubulin, alpha 8
  KO
K07374  tubulin alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04210  Apoptosis
rno04530  Tight junction
rno04540  Gap junction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    500377 (Tuba8)
  09143 Cell growth and death
   04210 Apoptosis
    500377 (Tuba8)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    500377 (Tuba8)
   04540 Gap junction
    500377 (Tuba8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    500377 (Tuba8)
   03036 Chromosome and associated proteins [BR:rno03036]
    500377 (Tuba8)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    500377 (Tuba8)
   04147 Exosome [BR:rno04147]
    500377 (Tuba8)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     500377 (Tuba8)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     500377 (Tuba8)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    500377 (Tuba8)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   500377 (Tuba8)
  Exosomal proteins of other body fluids (saliva and urine)
   500377 (Tuba8)
  Exosomal proteins of colorectal cancer cells
   500377 (Tuba8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Motif
Other DBs
NCBI-GeneID: 500377
NCBI-ProteinID: NP_001019510
RGD: 1566041
Ensembl: ENSRNOG00000048169
UniProt: Q6AY56
Position
4q42
AA seq 449 aa AA seqDB search
MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFGTQASKINDDDSFTTFFSETGNGK
HVPRAVMVDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVGKESIDLVLD
RIRKLTDACSGLQGFLIFHSFGGGTGSGFTSLLMERLSLDYGKKSKLEFAIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPIVSAEKAYHEQLSVAEITSSCFEPNS
QMVKCDPRHGKYMACCMLYRGDVVPKDVNVAIAAIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGTDSFEEENEGEEF
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagggaatgcatatcagtccatgtgggtcaagcgggagttcagattggcaatgcctgc
tgggagctcttctgtttggagcatggtatccaggcggatgggacctttggcactcaggcc
agcaagatcaacgacgacgactccttcaccacatttttcagtgagactggcaacggaaaa
catgtgccccgggctgtcatggtggacctggagcctacagtagtagacgaggtgcgggca
gggacctaccgccagctcttccaccctgagcagctgatcacagggaaggaggatgcagct
aacaattacgcccgcggacactatacggtgggcaaggagagcatcgatctggtgctggac
cggatccgtaaactgactgatgcctgctccggcttgcagggtttcctgatcttccacagt
tttggtgggggcacaggctctggcttcacttctctgctgatggaacgcctttctcttgat
tatggcaagaagtccaagctagaatttgccatctacccagccccacaggtctccacagca
gtggtggagccctataactccatcctgaccacccataccactctggaacactctgattgt
gctttcatggtggacaatgaagccatctacgacatctgccgcaggaacctggatattgag
cgccccacctataccaacctcaaccgcctcatcagccagattgtctcctccatcacggcc
tctctccgctttgatggagccctcaacgtggacctcacagagttccagaccaacctggta
ccctacccccgaatccacttcccgctggtcacttacgcacccatcgtctctgccgagaaa
gcctaccacgagcagctgtctgtggcagagataaccagctcttgcttcgagcccaacagc
cagatggtgaaatgtgacccacgtcacggcaaatacatggcctgctgcatgctctaccgt
ggtgatgtggtacccaaggatgtgaatgtcgccattgctgccatcaagaccaagagaact
attcagtttgttgactggtgtcccacaggcttcaaggtgggcattaactaccagccacct
actgtcgtgccaggaggagacctggccaaagtccagcgagcagtatgcatgctgagcaac
accacagcaatcgcagaggcctgggcccgccttgaccataagttcgacctcatgtatgcc
aaacgggcctttgtacattggtatgttggagagggaatggaagaaggagaattttctgag
gccagggaggacctggctgctctggagaaggattatgaagaagtggggactgattcgttt
gaagaagaaaatgagggggaggaattttaa

DBGET integrated database retrieval system