KEGG   Rattus norvegicus (rat): 500450
Entry
500450            CDS       T01003                                 

Gene name
Tpm2
Definition
(RefSeq) tropomyosin 2, beta
  KO
K10374  tropomyosin 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno05410  Hypertrophic cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    500450 (Tpm2)
   04261 Adrenergic signaling in cardiomyocytes
    500450 (Tpm2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    500450 (Tpm2)
   05414 Dilated cardiomyopathy
    500450 (Tpm2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    500450 (Tpm2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     500450 (Tpm2)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 CLZ Laminin_II ERM TMF_DNA_bd DUF3450 Cluap1 Snapin_Pallidin ATG16 ADIP DASH_Duo1 HrpB7 Fib_alpha Suppressor_APC XhlA Fmp27_WPPW DUF745
Other DBs
NCBI-GeneID: 500450
NCBI-ProteinID: NP_001019516
RGD: 1559479
Ensembl: ENSRNOG00000016731
UniProt: P58775 Q5FVG5
Position
5q22
AA seq 284 aa
MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKY
SESVKDAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSE
ERAEVAESRARQLEEELRTMDQALKSLIASEEEYSTKEDKYEEEIKLLEEKLKEAETRAE
FAERSVAKLEKTIDDLEETLASAKEENVEIHQTLDQTLLELNNL
NT seq 855 nt   +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctgaaactggacaaggagaatgccatcgac
cgcgcagagcaggccgaagccgacaagaagcaagctgaagaccgatgcaagcagctggag
gaagagcagcaggccctccagaagaaactgaaggggacagaggatgaggtggaaaagtat
tccgagtctgtgaaggatgcccaggagaaactggagcaggccgagaagaaggccaccgat
gctgaagcagatgtggcttctctgaatcgacgcattcagctcgtagaggaggagttggat
cgggcacaggagcgcctggctacagccttgcaaaagctggaggaggctgagaaagccgct
gatgagagcgagagaggaatgaaggtcattgagaaccgggccatgaaggatgaggagaag
atggagctgcaggagatgcagctgaaagaagccaagcacatcgctgaggactcagaccgc
aaatacgaggaggtggccaggaagctggtgatcctggaaggagagctggagcgctctgaa
gagagagccgaggtggctgagagccgagccaggcagctggaggaggagcttcgaaccatg
gaccaggctctcaagtcgctgatagcctcagaggaggagtattccaccaaagaggacaaa
tacgaagaagagatcaaacttctggaggagaagctgaaggaggctgagacccgagcagag
tttgctgaaagatctgtggcaaagttggagaaaaccatcgatgacctggaagagactttg
gctagtgccaaggaagagaacgtggagattcaccagaccttggaccagacccttctggaa
ctcaacaacctgtaa

DBGET integrated database retrieval system