KEGG   Rattus norvegicus (rat): 500475Help
Entry
500475            CDS       T01003                                 

Definition
(RefSeq) similar to hypothetical protein 4933430I17
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4647 MecA
Motif
Other DBs
NCBI-GeneID: 500475
NCBI-ProteinID: NP_001019517
RGD: 1563460
Ensembl: ENSRNOG00000024506
UniProt: Q6AYG4
Position
5q24
AA seq 491 aa AA seqDB search
MRLRSSIRTGSVMKGRKAFDSMRVVDESQWNEAVCTLAGCQHPQCWASLRRIERGHPRIL
DTSSKSPWESEDKLPTLTVVNIMDTCLWAKKRVVQRQASEFTFPKERSLLLKPASKCHGR
SWKSLRDKDATSHSRPPKLSVLNLNEAKLPFSGDDRNMVVTWVPEEMAKKTIQEKAGVPS
RSVKKRRKKWGETSKPSLYYRGRRYLRSPAVLVPPPSPVHFLEQLHSEAIPLWAQVDMLP
QDLLKECILSHEKSTACPEVKMELSKMKKSLPLEKSRPDSAVSSKMYLTIQRLTLQRPSL
RYPDCLKKLRHNLKRDSWKQQEEKTSTKKQEAKKKAKRDVEEQYGEETMSSDSFHDPSFH
DHVGLRISRREIERKLLKGEVGMEKTSLERRVSVEEPMAYEFGSYYTASYYTSPESALLY
ETIYQDLNDGEETELEVEAFSKDNNPKSLSAVMDNISWNPELKLLRILQATEEENEEGHL
SRAQSEASLEA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagacttcgcagctcaattcggactggttcggtaatgaaagggcgaaaagcatttgac
tctatgagagtggtggacgagtcccaatggaatgaagccgtctgtaccttagcaggttgt
cagcatccacaatgttgggcatctctccgacggattgagaggggccatcctaggatccta
gacacatccagcaaatctccctgggaatctgaagataaactcccgacactcactgttgta
aatatcatggatacctgcttgtgggccaagaagagggtggttcagcgtcaagcatcagaa
tttaccttccctaaggaacgttctttattgttgaaaccagcctccaaatgtcatggaagg
tcttggaagtctttacgtgacaaagatgcgactagccattctagacctcccaaactttca
gtattgaatctgaatgaagcaaaacttcctttctctggagatgacagaaacatggttgtg
acctgggttccagaagaaatggcgaagaaaacgatacaagaaaaggctggtgttcccagc
aggtctgtgaagaagaggagaaagaaatggggagagacaagcaagccgtctctgtattac
cgtggaaggcggtacttgaggagcccagcagtgcttgtacctcctccctccccagtacac
ttcttggagcaattacattctgaagccataccactatgggctcaagtcgacatgcttccg
caggatctattgaaggaatgcatcttgtcacatgagaaatccacagcttgccctgaggtg
aaaatggagctgtctaagatgaaaaagtctcttcccctggaaaagagccggcctgacagt
gccgtctcatctaagatgtatctgactatccagcgcctcaccctgcaaagaccatcactg
cggtatcctgattgcctgaagaagctgcgccacaacctgaagcgagattcctggaagcag
caggaggagaaaacctctactaagaaacaggaggctaaaaagaaagccaagcgagatgtt
gaggaacagtatggggaagaaaccatgtcgagcgattccttccatgacccttccttccat
gaccatgtaggactcagaatatcacgacgtgaaattgaacgaaagctgttgaaaggggag
gtgggaatggagaaaacatccctagagagacgtgtttccgtagaagagccaatggcatat
gagttcggcagctactacactgccagctactacaccagtcctgagagtgctctactatat
gaaacaatttaccaggaccttaatgacggggaggagactgagttggaagtcgaggctttc
agcaaagacaataaccccaagagcctttctgcagttatggacaatatcagctggaacccc
gagctcaaactgctgaggattcttcaggccaccgaggaggaaaatgaggaaggccatctt
tctagggcacagagtgaggcgtctctagaagcttag

DBGET integrated database retrieval system