KEGG   Rattus norvegicus (rat): 500538Help
Entry
500538            CDS       T01003                                 

Gene name
Ybx1, Byb1, Cbfa, Dbpb, Ef1a, Msy1, Nsep1, Yb1
Definition
(RefSeq) Y box binding protein 1
  KO
K09276  Y-box-binding protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    500538 (Ybx1)
   03019 Messenger RNA biogenesis [BR:rno03019]
    500538 (Ybx1)
   03041 Spliceosome [BR:rno03041]
    500538 (Ybx1)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   Cold-shock domain factors, YB-1/DbpB-like
    500538 (Ybx1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Other mRNA localization factors
     500538 (Ybx1)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     500538 (Ybx1)
Spliceosome [BR:rno03041]
 Common components
  Common spliceosomal components
   General mRNP proteins
    500538 (Ybx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CSD OB_RNB
Motif
Other DBs
NCBI-GeneID: 500538
NCBI-ProteinID: NP_113751
RGD: 61843
Ensembl: ENSRNOG00000023786
UniProt: P62961
Position
5q36
AA seq 322 aa AA seqDB search
MSSEAETQQPPAAPAAALSAADTKPGSTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGT
VKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEA
ANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQA
QQRRPYRRRRFPPYYMRRPYARRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYR
PRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKE
TKAADPPAENSSAPEAEQGGAE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgaggccgagacccagcagccgcccgccgcccccgccgccgccctcagcgcc
gccgacaccaagcccggctccacgggcagcggcgcgggtagtggcggcccgggcggcctc
acatcggcggcgcccgccggcggggacaagaaggtcatcgcaacgaaggttttgggaaca
gtaaaatggttcaatgtaaggaacggatacggtttcatcaacaggaatgacaccaaggaa
gacgtatttgtacaccagacggccataaagaagaataaccccaggaagtaccttcgcagt
gtaggagatggagagactgtggagtttgatgttgttgaaggagaaaagggtgcggaggca
gctaatgttacaggccctggtggagttccagttcaaggcagtaaatacgcagcagaccgt
aaccattatagacgctatccacgtcgtaggggtcctccacgcaattaccagcaaaattac
cagaatagtgagagtggggaaaagaatgaaggatcggaaagcgctcctgaaggccaggcc
caacaacgccggccctatcgcaggcgaaggttcccaccttactacatgcggagaccctat
gcgcgtcgaccacagtattccaacccccctgtgcaaggagaagtgatggagggtgctgac
aaccagggtgcaggagagcaaggtagaccagtgagacagaatatgtatcggggttacaga
ccacgattccgcaggggccctcctcgccaaagacagcctagagaggatggcaatgaagag
gacaaagaaaatcaaggagatgagacccaaggtcagcagccacctcaacgtcggtatcgc
cgcaacttcaattaccgacgcagacgcccagagaaccctaaaccacaagatggcaaagag
acaaaagcagccgatccaccagctgagaattcgtccgctcccgaggctgagcagggcggg
gctgagtaa

DBGET integrated database retrieval system