KEGG   Rattus norvegicus (rat): 500555
Entry
500555            CDS       T01003                                 

Gene name
Zcchc17, RGD1565267
Definition
(RefSeq) zinc finger CCHC-type containing 17
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: S1 zf-CCHC CpXC
Other DBs
NCBI-GeneID: 500555
NCBI-ProteinID: NP_001102737
RGD: 1565267
Ensembl: ENSRNOG00000012266
UniProt: D3ZCQ7
Position
5q36
AA seq 241 aa
MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEI
VDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTG
QKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLVPEEEEEKEEAKAEGLEKPDPTK
NSSRKRKKEKKKKKHRDRKSSDCDSPDSESDTGKKARHTAKDSKAPKKKKKKKKHKKKHK
E
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaattcaggaaggcctgagaccatggaaaacttgcctgcactgtatactatttttcaa
ggagaggttgctatggtgacagactatggagcttttatcaaaatcccaggctgtcggaag
caaggtctggtccatcgaactcacatgtcgtcttgtcgagtggataagccttctgagata
gtagatgttggagacaaagtgtgggtgaagcttattggccgagagatgaaaaatgataga
ataaaagtgtctctgtccatgaaagttgtcaaccaaggaactgggaaagacctcgacccc
aacaacgttatcattgagcaagaagagaggcgcaggcgatccttccaggactacactggg
cagaagatcacccttgaggccgtcctgaacacgacctgcaagaagtgtggctgcaaaggc
cactttgcaaaggactgcttcatgcagccaggcggaaccaagtattctctggtccctgaa
gaggaagaggaaaaagaggaagcaaaggcagaaggccttgagaaacctgatcccacaaag
aattcttccaggaagagaaagaaggaaaagaagaagaagaaacatagagacaggaagtcg
tctgactgtgatagccctgactctgagagtgacacgggcaagaaggcgaggcacacagca
aaagacagcaaggctccaaagaagaaaaagaagaagaagaaacacaagaagaagcacaag
gaatga

DBGET integrated database retrieval system