KEGG   Rattus norvegicus (rat): 500569Help
Entry
500569            CDS       T01003                                 

Gene name
Kdm1a, Aof2, Kdm1, RGD1562975
Definition
(RefSeq) lysine demethylase 1A
  KO
K11450  lysine-specific histone demethylase 1A [EC:1.-.-.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    500569 (Kdm1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    500569 (Kdm1a)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     500569 (Kdm1a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    500569 (Kdm1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase SWIRM NAD_binding_8 DAO Pyr_redox_2 Pyr_redox AlaDh_PNT_C FAD_binding_2 HI0933_like FAD_binding_3 FAD_oxidored Thi4 GIDA DUF1917 2-Hacid_dh_C Lycopene_cycl MutS_IV Pyr_redox_3 MRPL52
Motif
Other DBs
NCBI-GeneID: 500569
NCBI-ProteinID: NP_001123570
RGD: 1562975
Ensembl: ENSRNOG00000022372
UniProt: B3STT9
Position
5q36
AA seq 872 aa AA seqDB search
MLSGKKAAAAAAAAAAAAAGTEAGPGAAGGAENGSEVAAPPAGLAGPADIATGAAGERTP
RKKEPPRASPPGGLAEPPGSAGPQAGPTAGPGSATPMETGIAETPEGRRTSRRKRAKVEY
REMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGQAGGLQD
DSSGGYGDGQASGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQL
WLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPIKKTGK
VIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGN
PMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNV
LNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQ
QYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVY
LSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAE
GLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFV
PPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKA
PILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGS
YSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLR
EAGRIADQFLGAMYTLPRQATPGVPAQQSPSM
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgttgtctgggaagaaggcggcggcggcggcagcggcggcggcggcagcagcggctggg
acagaggccgggcccggggcggcgggcggcgccgagaacggctctgaggtggccgcgccg
cccgcgggcctggcgggccccgccgacattgctacgggggcggcgggcgagcgcactccc
cgaaagaaggagcctccgcgggcctcgccgcccggaggcctggccgagccgcctgggtcc
gccgggcctcaggcggggcccacagccgggcccggctccgctacacccatggagacagga
atagccgagaccccggagggccgacggaccagccgacgcaagcgggcgaaggtagaatac
agagaaatggatgaaagcttggccaacctctcagaagatgaatattattcagaagaagaa
agaaatgccaaagcagagaaggagaagaagcttcccccgccacctcctcaagccccacct
gaggaggaaaatgaaagtgagcccgaggagccgtctgggcaagcaggaggacttcaagac
gacagttctggagggtatggagacggccaagcatcaggtgtggagggtgcagctttccaa
agcagacttccccatgaccgaatgacctctcaggaagcagcgtgtttcccagacatcatc
agtgggcctcagcagacacagaaggtttttctgttcatcaggaatcgcacattgcagtta
tggttggacaacccaaagattcagctgacatttgaagctacgctccagcagttagaagca
ccttataacagtgacactgtacttgtccaccgagttcatagttacttagagcgccacggt
cttatcaacttcggcatctacaagaggataaaacctttaccaattaaaaagacaggaaag
gtgattattataggctcaggtgtttctggcttggcagcagctcgacaactacagagtttt
gggatggatgtcacacttctggaagccagggatcgcgtaggtggacgggtcgctacattt
cgaaaaggaaactatgtagctgatcttggagccatggtagtaacaggtcttggaggaaat
cccatggctgtcgtcagcaaacaagtaaatatggaactggccaagatcaagcaaaaatgc
ccactttatgaagccaatggacaagctgttccaaaagagaaagatgaaatggtagaacaa
gaatttaaccggttgcttgaagccacctcttaccttagtcatcagttagacttcaacgtc
ctcaataataaacctgtgtcccttggccaggcgttggaggttgtcattcagctacaagaa
aagcacgtcaaagatgagcagattgaacactggaagaagatagtgaaaactcaggaggaa
ttgaaagagcttctcaataagatggtaaacttgaaggagaaaattaaagagctccaccag
caatacaaagaagcttcagaagtgaagccgcccagagatattacagctgagttcctagtg
aaaagcaagcacagggacctgactgccctctgcaaggaatatgatgaattagctgaaaca
caaggaaagctagaagaaaaacttcaagaattggaagccaatcccccaagtgatgtatat
ctctcatcaagagacagacaaatacttgactggcattttgcaaatcttgaatttgccaac
gccacacctctctctaccctctctcttaaacattgggatcaggatgatgacttcgagttt
actggcagccacctgacagtgaggaatggctactcgtgtgtgcctgtggctttagctgaa
ggtttggacattaaactgaacacagcagtgcggcaggttcgctacacagcctcaggatgt
gaagtgattgctgtgaacacacgctccacaagtcagaccttcatttataagtgtgacgca
gtgctctgtacccttcctttgggagtgctgaagcagcagccaccagctgttcagtttgtg
ccgcctcttcctgagtggaaaacatccgcagtccaaaggatgggatttggcaaccttaac
aaggtggtgctatgttttgaccgtgtgttctgggatccaagtgtcaatttgtttgggcac
gttggcagtacaactgctagcaggggcgagctcttcctcttctggaacttatataaagct
ccaatactcttggctctggtagcaggcgaagctgctggcattatggagaacattagtgat
gatgtgattgtcggccggtgcctggccattctcaaagggatttttggcagcagtgcagta
ccacagcccaaggaaactgtggtgtctcgttggcgtgctgatccctgggcccggggctcc
tattcttatgtggctgcaggatcttctggaaatgactatgatttaatggctcagccaatc
actcctggtccctcaattccaggtgccccacagccaattccaagactcttctttgctgga
gaacatacaatccgcaactacccagctacggtccatggtgctctgctgagtgggcttcga
gaagcaggaaggattgccgaccagtttttgggagccatgtacacgttgcctcgtcaggcc
acaccgggtgtccctgcacagcagtccccaagtatgtga

DBGET integrated database retrieval system