KEGG   Rattus norvegicus (rat): 500625Help
Entry
500625            CDS       T01003                                 

Gene name
Atad2b
Definition
(RefSeq) ATPase family, AAA domain containing 2B
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: AAA IstB_IS21 AAA_2 AAA_16 AAA_5 DUF1088 AAA_22 DUF2075 RNA_helicase RuvB_N ResIII AAA_18 TIP49 Mg_chelatase AAA_7 AAA_25 AAA_33 AAA_30 NACHT Sigma54_activat Parvo_NS1 ATPase_2 AAA_11 DUF4746
Motif
Other DBs
NCBI-GeneID: 500625
NCBI-ProteinID: NP_001020322
RGD: 1566199
Ensembl: ENSRNOG00000058973
Vega: OTTRNOG00000000886
UniProt: Q66HB4
Position
6q14
AA seq 418 aa AA seqDB search
MEVRKSCRSRKNRFESVNQSLLFDQLVNSTAEAVLQEMDNINIRRNRRSGEVERLRMWTD
TEFENMDMYSRVKRRRKSLRRNSYGIQNHHEVSTEGEEEESQEEDGDIEVEEAEGEENDR
PYNLRQRKTVDRYQAPPIVPAHQKKRENTLFDIHRSPARRSHIRRKKHAIHSSDTTSSDE
ERFERRKSKSMARARNRCLPMNFRAEDLASGILRERVKVGASLADVDPMNIDKSVRFDSI
GGLSHHIHALKEMVVFPLLYPEIFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSQGD
KKVAFFMRKGADCLSKWVGESERQLRLLFDQAYLMRPSIIFFDEIDGLAPVRSSRQDQIH
SSIVSTLLALMDGLDNRGEIVVIGATNRLDSIDPALRRPGRFDREFLFNLPDQRRPRL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcagaaaaagctgtcggtccaggaaaaacagatttgaaagtgtgaatcagagt
ttattatttgatcaactagtaaatagtactgctgaagctgtgttacaagaaatggataat
attaacattcgacgaaatcgtcgatcaggcgaagtagagcggcttcgaatgtggacagat
acagaatttgaaaatatggatatgtattcaagggttaaaagacgaagaaaatcactgaga
agaaatagttatgggatacagaatcatcatgaagtttctactgagggcgaggaagaagaa
tctcaagaggaggatggagacatagaagttgaagaggcagaaggagaagaaaatgataga
ccatataatttgagacaaagaaaaacagtggatcgatatcaagcaccgccaatagtaccg
gctcatcaaaaaaagagggaaaatacactatttgatattcacaggtctccagcaagaaga
agccatatcaggaggaagaagcacgccattcacagtagtgacacaacttcttctgatgaa
gagcgctttgagagaaggaagtcaaaaagcatggcaagagcaagaaacaggtgtttgcct
atgaacttcagagcagaagatttagcgagcggcattctccgagaacgggtgaaagtgggt
gcaagtttggctgatgttgatccgatgaacattgataaatcagtgcggtttgatagcata
ggtggattgagccatcacatacacgctttgaaggagatggtagtttttccacttttatat
ccagaaatttttgaaaaatttaaaattcagcctccaaggggctgtttgttttatggtcct
cctggcacaggtaaaaccttagttgccagagcattagctaacgaatgcagtcaaggagac
aaaaaggtagcatttttcatgcgaaaaggagcagactgtttgagcaagtgggtcggagag
tcggaaaggcagctcaggcttctctttgatcaggcatatttgatgaggccctctataata
ttttttgatgaaatagatggcttagctcctgttcgctctagtagacaagatcagatccac
agctctatagtgtcaaccctccttgctcttatggatggattagataatagaggtgaaatt
gttgttattggtgctacaaacagacttgactctattgatcctgcactcaggagacctggt
cgttttgacagagaatttcttttcaacctgcctgatcaaaggagacctcgcttatag

DBGET integrated database retrieval system