KEGG   Rattus norvegicus (rat): 500629Help
Entry
500629            CDS       T01003                                 

Gene name
Rdh14, RGD1565196
Definition
(RefSeq) retinol dehydrogenase 14 (all-trans/9-cis/11-cis)
  KO
K11162  retinol dehydrogenase 14 [EC:1.1.1.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    500629 (Rdh14)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     500629 (Rdh14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase
Motif
Other DBs
NCBI-GeneID: 500629
NCBI-ProteinID: NP_001102746
RGD: 1565196
Ensembl: ENSRNOG00000039551
Vega: OTTRNOG00000002232
UniProt: D3ZUY0
Position
6q14
AA seq 334 aa AA seqDB search
MAVASVAAALLAALGGALWLAARRFSGSSGQRRQGGGDPGLMHGKTVLITGANSGLGRAT
AGELLRLGARVIMGCRDRARAEEAAGQLRQELGQAGGLGPDATDGQLVVKELDLASLRSV
RAFCQELLQEEPRLDVLINNAGVFQCPYTKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSS
APSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKLANILFTRELAHRLEGTNVTV
NVLHPGIVRTNLGRHIHIPLLARPLFNLVSWAFFKTPLEGAQTSIYLASSPDVEGVSGRY
FGDCKEEELLPKAMDESVARKLWDISEVMVGILK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggcagtggctagtgtggccgcggcgctcctggccgcactgggcggggcgttgtggctg
gcagcccggcggttctctgggtcaagtggccagcggcggcagggaggcggagacccgggc
ctcatgcacgggaagacagtgctgatcaccggagcaaacagtggcctgggccgcgccacg
gccggggagctgctacgcctgggggcgcgggtcatcatgggatgtcgggaccgcgcccga
gcagaggaggcagcgggtcagctcaggcaggagcttggtcaggctgggggtctcgggccc
gatgccaccgatggccagctggtcgttaaggagctggatctcgcctcgctgcgctccgtg
cgagccttctgccaagaactgctacaggaggagcccaggctagatgtcctgatcaataat
gcgggggttttccagtgcccatatacgaagactgaagatggatttgagatgcagtttgga
gtgaaccacctgggccacttccttctcaccaatcttctccttgggctcctcaaaagttca
gctcccagcaggattgtagtcgtttcctctaaactttataaatatggagacatcaacttt
gaagacttgaacagtgaacaaagctataataaaagcttctgttatagtcgaagcaagctg
gctaacattcttttcacaagggaactagcccatcgcttagaaggaacaaatgtgactgtc
aacgtgctgcatcctggtattgtgcgaacaaacctggggaggcatatacacatcccattg
ctggcaagaccacttttcaatttggtatcctgggcttttttcaaaactccattagaaggt
gcccagacctccatctacttagcctcttcacccgatgtggaaggtgtatcgggaaggtac
ttcggtgattgtaaggaggaagaactcttacccaaagctatggatgagtcagtggcaaga
aaactgtgggatatcagtgaagtgatggttggcattctaaaatag

DBGET integrated database retrieval system