KEGG   Rattus norvegicus (rat): 500685Help
Entry
500685            CDS       T01003                                 

Gene name
Plekhd1, RGD1566112
Definition
(RefSeq) pleckstrin homology and coiled-coil domain containing D1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: PH PH_11
Motif
Other DBs
NCBI-GeneID: 500685
NCBI-ProteinID: NP_001121038
RGD: 1566112
Ensembl: ENSRNOG00000038297
UniProt: B1WBU8
Position
6q24
AA seq 505 aa AA seqDB search
MFTSKSNSVSPSPSLEQADADALDISTKVQLYGVLWKRPFGRSSAKWSRRFFIIKESFLL
YYSESERKSFETNKYFNIHPKGVIPLGGCLVEAREEPSMPYAMKISHQDFHGNVLLAAES
EFEQTQWLEMLQESGKVTWKNAQLGEAMIKSLEAQGLQLAKEKQEYLDKLMEETEELCLQ
REQREELERLNQVLEAEKQQFEEVVQELKVEQEQIKRELELTARCLKGVEQEKKELRHLT
ESLQHTLEELSIEKKKTLEMLEEDKNQPQPLTNQSEQPPATDGLHSNLRQIEERMQELLA
EKLLAEKRMKENEERSRALEEEREFYSSQSQALQNSLQELTAEKQQAEQELKAEVKVRMD
LERRLREAEAALRSLEQGLNSKVRNKEKEERMRADVSHLKRFFEECIRNAELEAKMPVIM
KNSVYIHKAATRRIKSCRFHRRRSSTSWNDMKPSQSFMTSQLEANNIEELKEVAKRLSRD
QRFRESIYHIMATQPGASALPRGGK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgttcacatctaagtccaactccgtgtcgccatcgccgtccctggagcaggccgacgcg
gacgcgctggacatcagcaccaaagtgcagctctatggggttctgtggaagcggccgttc
gggagatcgtcggccaagtggtcccggcggtttttcatcatcaaagaaagctttctgctt
tactactctgagagtgagaggaagagttttgaaaccaataaatacttcaacatccatcct
aagggtgtcatcccactgggtggctgcctggtggaggccagagaagagcccagcatgccc
tatgccatgaagatctcacaccaggactttcatgggaatgtcctgttggctgctgagtct
gagtttgagcagacacaatggcttgagatgcttcaggagtctgggaaggtgacctggaaa
aatgcccagctaggagaagctatgatcaaaagcctagaggcacaggggctacagctggct
aaggaaaaacaggaatatttagacaagctgatggaggagacagaagagctgtgccttcag
agggagcagagagaggagcttgagcgcctgaaccaggtgctggaggctgagaagcagcag
tttgaggaggtggtgcaagagctgaaagtggagcaggagcagatcaagagggagctagaa
ctcacggcaagatgcctcaagggtgtggagcaagagaagaaggagctgaggcacctcaca
gaatccttacagcacacactggaggaactctccatagagaagaagaaaaccctagagatg
ctggaggaagataagaaccagccacagcccttgaccaatcagagtgaacagccaccagcc
actgatggtctccatagcaacctcaggcagatcgaagagcggatgcaggagcttttggca
gagaagcttctggctgagaagcggatgaaggagaatgaggaacgctcacgggccctggag
gaggaacgggagttctactcaagccagtctcaagccctgcagaactcgctgcaggagctg
accgcagagaagcagcaggctgagcaggaactcaaggctgaagtgaaagtacgcatggac
cttgagagacgacttcgggaggcagaggcagccttgcggagcctggaacaaggcctcaat
tccaaggttcggaacaaggagaaggaagagaggatgcgggctgatgtgagccacctgaaa
aggtttttcgaggagtgcatccggaatgcagagctggaggccaagatgccagtcatcatg
aagaactcggtgtacatccacaaggcggccactcgccgtatcaagagctgccgtttccat
cgacgacggtctagcacttcctggaatgacatgaagccatcccagtccttcatgacctcc
cagctagaagccaacaacatagaggagctgaaggaggtggccaagcggctaagcagagac
cagcgcttccgggaatccatctatcacatcatggccacccagcctggggcctctgcactt
ccccggggaggaaagtaa

DBGET integrated database retrieval system