KEGG   Rattus norvegicus (rat): 500832Help
Entry
500832            CDS       T01003                                 

Gene name
Bbs10, RGD1560748
Definition
(RefSeq) Bardet-Biedl syndrome 10
  KO
K19401  Bardet-Biedl syndrome 10 protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    500832 (Bbs10)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   BBS-CCT complex
    500832 (Bbs10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cpn60_TCP1 HTH_6
Motif
Other DBs
NCBI-GeneID: 500832
NCBI-ProteinID: NP_001102756
RGD: 1560748
Ensembl: ENSRNOG00000026913
UniProt: B1H296
Position
7q22
AA seq 713 aa AA seqDB search
MASQGSVTAALRVAEVLETIANRCVGPEGGLVLCTKPTGEVLLSRDGGCLLEALHLEHPL
ARMIVACVSSHLKKTGDGAKTFIIFLCHLLRGLHAIGEKEKDSFTSEDIQSHERHWKNCC
QWKSISRALLRFQTQTLGCIVDQHLSRHYLSAFSSSAEGRTLCRRSLELLLEPYFCGRVG
RNNHRFISQLMCDYVFKCMACESGIEVFEFLDNCFVELNVGVTGLPVSESRIVDGLVLPR
DFSVYCPADGGIRMVIVTEILQPLFSSSSSEFVLDSETQFQASQSWIMDRTKTVMNHLRS
HNVKLLLSSVKQPDLVTYCARLNSISVVECLSSEEVSLVQRITGLSPCVLPELASQCHIA
DSALVRFCKPLIVRSGRYAHLGLVSTCAFVPHCVVLCGPVLGLVQQHESAFHGAFKMLRQ
LFTDLDLNCMIQTKERRNPSPLADSSNRESSHSPKTGKYQDVVAKNKDKLETQTRLEVYP
RLGASDTELITCKLWSAHKETSIDPSQTNEIPKRLSPEKSRIVDNCEVFLENNPTGNPTA
EDTRTEMSFKHLQVADNPGEGYTLPVTYKSPDTCPSQAHCSSAVPAGCVLPVGGHFEILM
HFYLLNYAKQCRQSDDAVISMLIANALLGVPKILYKPKKGKDSFPHIYTRALRALQTRQP
IVSGQSGFESVAGKYQLLTSVLQCLMKILTIDLIINVKRQPQKTGDQESEDEL
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcccaggggtctgtgacagcggcactgcgggtggctgaggtgctggaaaccatc
gcgaaccgctgcgtggggcccgagggcggcctggtgttgtgtacgaagcccaccggcgag
gtgctgcttagcagggatggaggttgcctcctggaggcgctgcacttagagcatccctta
gccaggatgatagtggcgtgtgtttccagtcaccttaaaaaaacaggagatggtgctaaa
acatttattatttttctttgccatttactcagaggacttcatgcaatcggagaaaaagaa
aaagactcattcacttctgaagatattcagagccatgaaaggcattggaaaaactgctgc
cagtggaaatctatttcccgggctctgctaaggtttcagacacaaacgttaggttgtatt
gtagaccaacatttaagcaggcactacctctctgccttttcttcatctgctgaaggaaga
acactgtgcaggcgctctctggagttgctcctggaaccatacttttgtggaagagtggga
agaaacaaccacagattcatttcacagttgatgtgtgactacgttttcaagtgtatggct
tgtgaaagtgggattgaagtatttgagtttttggacaactgttttgtggagttgaatgtt
ggcgtgacaggccttcctgtttcagagtctagaattgtggatggccttgtgcttcccaga
gacttttctgtgtactgcccagcagatggtggcattaggatggtgatagtaaccgaaatc
ctccagcctctgttttcatcgtctagctcggaatttgttctcgactcagaaacacagttt
caggcatctcagagttggatcatggacaggacaaaaaccgtaatgaaccacctgcgtagt
cataatgtaaaactgctcctgtccagtgtgaagcaaccagacctagttacttattgtgca
agactaaatagcatctcagtggtggagtgtttatcatctgaggaagtttctctcgtccag
aggatcaccggtctttctccttgtgtcctaccagagctcgcttcacagtgtcacattgct
gacagtgctttggtgaggttttgtaaacccctcatcgttaggtccggaaggtatgctcat
ctcggcttggttagcacgtgtgcattcgtacctcactgtgtagtcctttgtggaccagtt
ctgggtcttgttcaacagcatgagagtgctttccatggagcctttaagatgcttcggcag
ctgttcactgacctcgatctaaattgcatgatacagaccaaagagcgacgtaacccgagc
cctcttgctgacagcagtaacagagagagcagtcactcacccaaaactggtaagtatcag
gacgtagtagcaaagaacaaagataaactggaaactcaaacacgtttagaagtatatcca
cgtctgggggcttcggatacagaattgataacatgtaagctgtggtcagcacacaaggag
acatcaatagatccatcccaaacaaatgaaataccgaagcgcttatctccagaaaaaagt
aggatagttgataactgtgaagtgttccttgaaaataatcccactggaaatcctacagca
gaagacactaggacagaaatgtctttcaaacatttacaggtcgcagataatcctggagaa
gggtacacattgccagtgacatacaagtccccagatacctgtccttcccaggctcactgt
tcatcagctgtaccagcaggctgtgttctgcccgtgggtggacattttgagattttgatg
catttctaccttctcaactacgccaagcaatgccggcaatcagacgacgctgtcatcagc
atgttaatagctaatgctcttctaggtgtccctaaaatcctttataagcccaagaaggga
aaagacagtttcccacacatatacactcgggctctccgtgcactgcaaaccaggcaaccc
atagtaagtggtcagtcaggcttcgagtcagtagctggtaagtaccaattactaacttca
gttcttcagtgtttgatgaaaatattaaccattgatttaataatcaacgtcaagagacag
cctcagaaaactggtgaccaagaatcagaagacgaactttaa

DBGET integrated database retrieval system