KEGG   Rattus norvegicus (rat): 500836Help
Entry
500836            CDS       T01003                                 

Gene name
Il22, RGD1561292
Definition
(RefSeq) interleukin 22
  KO
K05445  interleukin 22
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04630  Jak-STAT signaling pathway
rno04659  Th17 cell differentiation
rno05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    500836 (Il22)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    500836 (Il22)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    500836 (Il22)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    500836 (Il22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    500836 (Il22)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   500836 (Il22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL22 IL10 BshC
Motif
Other DBs
NCBI-GeneID: 500836
NCBI-ProteinID: NP_001178917
RGD: 1561292
Ensembl: ENSRNOG00000007365
UniProt: G3V6X6
Position
7q22
AA seq 179 aa AA seqDB search
MSVLRKSMSFSLMGTLAASCLLLVALWAQKADALPINSQCKLEAANFQQPYIVNRTFMLA
KEASLADNNTDVRLIGEELFRGVKAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVP
FLTKLSSHLSPCHISGDDQNIQKNVRQLKETVQKLGESGEIKAIGELDLLFMSLRNACV
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcctgaggaaatctatgagcttttcccttatggggactttggccgccagctgc
ctgcttctcgttgctctgtgggctcagaaggcagatgctctgcccatcaactcccaatgc
aaacttgaggcagccaacttccagcagccatacatcgtcaaccgcacctttatgctggcc
aaggaggccagccttgcagataacaacacagatgtcaggctcatcggggaggaactgttc
cgaggagtcaaagccaaggatcaatgctacttgatgaagcaggtgctcaacttcaccctt
gaagatgttctgctcccccagtcagacagattccagccttacatgcaggaggtggtgcct
ttcctgaccaagctcagcagtcacctcagcccctgtcacatcagcggtgatgaccagaac
atccagaagaacgtaagacagctgaaggaaacagtgcaaaagcttggagagagtggagag
attaaagcgatcggggaactggatctgctgtttatgtccctgagaaacgcttgcgtctga

DBGET integrated database retrieval system