KEGG   Rattus norvegicus (rat): 500899
Entry
500899            CDS       T01003                                 

Symbol
Mfsd3
Name
(RefSeq) major facilitator superfamily domain-containing protein 3
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: MFS_1 Acatn BT1
Other DBs
NCBI-GeneID: 500899
NCBI-ProteinID: NP_001020079
RGD: 1560274
Ensembl: ENSRNOG00000015685
UniProt: Q4V8E5
Position
7
AA seq 416 aa
MHGKLLPLAGLYLVQGLPYGLQSSLLPILLRARGLSLTRVGLTKGLYAPWLLKLAWAPLV
DRRGTPRVWLTFSTVCLGLVCGLLAVLPPPQAGQTGLPTTVMGLLLLLNLGAAVQDVALD
TLAVQLLEPKELGPGNTVQVVAYKLGSALAGGGLLVFFPTLSWPLLFLLLTATYWLAAAL
AWAAPALGRLSRPQVSEHTPHTSYLLQDLLAVPGTLWTAGFVLTYKMGEQGAGSLFPLLL
LDHGASASDLGLWSGLGAATCSIAGSSLGGALLARHCSHPRQPLKLLRSVLQLRLGGLAC
QTALLLHLNTPGASLDPGTVMRGAALLSLCLQQFLGGVVTTATFTVMMHCSQLAPRALQA
THYSFLATLELLGKLLPGTLAGVLADGLGPRLCFAAFLVLSALPVLDLRLAPSNLT
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgcatgggaagttgctgccgctggccggcctctatcttgtgcagggtctgccctatgga
ctgcagtccagtttgcttcccattttactgcgggcccgtggcctctctctaacgcgcgtg
ggtctgaccaagggattgtatgctccctggctgttaaagctggcgtgggcaccgctggtg
gacaggcggggcaccccgcgggtctggttaacattcagcacagtgtgcctgggcctcgtg
tgtggactgctggctgtgttgcctcctccgcaagctggccagacagggctacctaccacc
gtgatggggctgctactgctgctgaatctgggtgcagcagtgcaggatgtggctctggac
acactcgctgtgcaactcctagagccaaaggagttgggacccgggaacactgtacaggtg
gtagcttacaagctgggatcagcactggctgggggtggactgttggtcttcttccccacc
ctctcttggccactgctcttcttgcttctaactgccacctactggctggctgctgcctta
gcctgggctgcaccagcattgggccggctgtcaaggcctcaggtctcagagcatacaccc
cacacctcctatcttctacaagatttgctggctgtgcctgggaccctctggacagcaggc
tttgtgctcacctacaagatgggtgagcagggtgctggcagcctgtttccacttctcctg
ctggaccatggtgcttctgcctcagacttggggctgtggagtggcttgggtgctgcgacc
tgctccattgctggctcctccttgggtggggctctactggccaggcactgttcccatccc
aggcagccactgaagctgttgaggtcagtgctgcagcttcgacttgggggtttggcctgc
cagaccgctctgctcctccacctcaacaccccaggggccagtctggaccctggcacagtc
atgagaggagcagctttgctgagcctatgtctacaacaatttctggggggtgtggtcact
actgccacattcactgtgatgatgcactgtagccagctggcacccagagccctgcaggcc
acacattatagcttcctggccacgctagaactgctgggcaagctgctcccaggcaccctg
gctggagtgctggctgatggcctgggcccccgtctctgcttcgctgccttccttgtactc
tcagccctgcccgttctggatctccgcctggcacccagtaacctgacctga

DBGET integrated database retrieval system