KEGG   Rattus norvegicus (rat): 500900Help
Entry
500900            CDS       T01003                                 

Gene name
Lrrc14
Definition
(RefSeq) leucine rich repeat containing 14
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_6
Motif
Other DBs
NCBI-GeneID: 500900
NCBI-ProteinID: NP_001019525
RGD: 1560202
Ensembl: ENSRNOG00000016128
UniProt: Q569B5
Position
7q34
AA seq 493 aa AA seqDB search
MHTLVFLSTRQVLQCQPAACQALPLLPRELFPLLFKVAFMDKKTAVLRELVHTWPFPLLS
FQQLLQECAHCSRALLQERLSTESMQAVILGLTARIHAREAEAGTQPVCRKHTLRVLDMT
GLLDDGVEQDPGTMSMWDCTAAVARTCIAQQQVGTAKPGLSPVPVEIRVDLRVNRASYTF
LREALQSSVDSLLRLCCRDLRAEDLPMRNTVALLQLLDAGCLRRIDLRFNNLGLRGLSVI
IPHVARFQHLASLRLHYVHGDSRQPSVDGEDNFRYFLAQMGRFICLRELSIGSSLLSGRL
DQLLSTLQRPLESLELAFCALLPEDLRFLAQSSHAAHLKKLDLSGNDLSGNQLTPFQGLL
QAVAATLLHLELTECQIADAQLLATLPTLTRCASLRYLGLYGNPLSMAGLKELLRDSVIQ
AELRTVVHPFPVDCYEGLPWPPPASVLLEASINEEKFARVEAELHQLLLASGRAHVLWTT
DIYGRLAADYFNL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcacacgcttgtgttcctcagcacacgccaggtgcttcagtgccagccagctgcctgc
caggccttgcccctgctgccccgagaactcttccctctgctgttcaaggtggccttcatg
gacaagaagacagccgtgctgcgtgagctggtgcacacgtggccctttcccctcctcagt
ttccagcagctgctgcaggagtgtgcccactgcagtcgagccctgctgcaggaacggctc
agcacagaaagcatgcaggctgtgatcctgggactgaccgcccggatacatgctcgagaa
gcagaggctggcacacagcccgtttgcaggaagcatacactgcgggtactggacatgact
ggcctcctggatgatggtgtggagcaggatccaggaaccatgagcatgtgggactgtaca
gcggcggtagccagaacttgtattgcccagcagcaggtcgggactgctaagccagggctg
tcaccagtccccgtggaaattcgtgtagaccttcgggtaaaccgggcctcctatacattc
cttcgtgaggcactccagagtagtgtggacagcctgctgcggctctgctgccgggacctc
cgggctgaggatctgcccatgcgtaacactgtggccctactacagcttctagatgcaggc
tgtctgcgccgtatagacctgcgcttcaataacctgggcttgcgtggcctgtctgtcatt
atcccacatgtggcccgctttcagcacctagccagcctgaggctgcattatgtgcatggg
gactccagacagccctccgtggatggtgaggacaactttcgctacttcctggcccagatg
ggccggttcatctgtcttcgggagctcagcattggctcttctctcctctcaggcaggctg
gatcaactgctcagcaccctgcagaggcccctggaaagcctagagctggccttctgtgca
ctgttgcctgaggacctacgcttcctggctcagagctctcatgctgcccacctcaaaaag
ctggacttgagtggcaatgacttgtcaggcaaccagctgacacccttccagggtctgctg
caggcagtagcagccacactgctgcatcttgagctgactgagtgccagattgctgatgcc
cagttgttggccacactgcccaccctgactcgctgtgccagtctccgataccttggtctc
tatggcaaccctttgtctatggcaggacttaaagagctgcttcgggactctgtgattcag
gctgagctacgtactgtggtgcaccctttccctgtggactgctatgagggtcttccttgg
ccgccacctgcctctgtccttctggaagcctccatcaatgaggagaagtttgcccgtgta
gaagctgagttacaccagctgctgttagcttcaggccgtgcccatgtactctggaccaca
gacatctatggccggctggctgcagactattttaacctctga

DBGET integrated database retrieval system