KEGG   Rattus norvegicus (rat): 500910Help
Entry
500910            CDS       T01003                                 

Gene name
Tnfrsf13c, RGD1560810
Definition
(RefSeq) TNF receptor superfamily member 13C
  KO
K05151  tumor necrosis factor receptor superfamily member 13C
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04064  NF-kappa B signaling pathway
rno04672  Intestinal immune network for IgA production
rno05166  Human T-cell leukemia virus 1 infection
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    500910 (Tnfrsf13c)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    500910 (Tnfrsf13c)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    500910 (Tnfrsf13c)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    500910 (Tnfrsf13c)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    500910 (Tnfrsf13c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    500910 (Tnfrsf13c)
   04090 CD molecules [BR:rno04090]
    500910 (Tnfrsf13c)
Cytokine receptors [BR:rno04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   500910 (Tnfrsf13c)
CD molecules [BR:rno04090]
 Proteins
  500910 (Tnfrsf13c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BaffR-Tall_bind DUF4079 GT87 TACI-CRD2
Motif
Other DBs
NCBI-GeneID: 500910
NCBI-ProteinID: XP_001077542
RGD: 1560810
Ensembl: ENSRNOG00000007664
UniProt: D4A281
Position
7q34
AA seq 175 aa AA seqDB search
MGVRRLRVRSRRSRDSPVSTQCNQTECFDPLVRNCVSCELFYTPETRHASSLEPGTALQP
QEGSGLRPDVALLFGAPALLGLVLALTLVGLVSLVGWRWRQQRRTASLDTSEGVQQESLE
NVFVPPSETLHASAPNWPPFKEDADNILSCHSIPVPATELGSTELVTTKTAGPEQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcaggaggctccgggtcagaagccggaggagccgggacagcccggtgtccacc
cagtgcaatcagactgagtgcttcgaccctctggtgcgaaactgcgtgtcctgtgagctc
ttctacacgccggaaactagacatgcaagcagcctggagcccgggacagctctgcagcct
caggagggctccgggctgagacccgatgtggcgctgctcttcggtgcccccgcgctcctg
ggactggtgctggcactgaccctggtgggtctggtgagtctggtgggctggaggtggcgg
caacagcgcaggacagcctccttggacacttccgaaggagtccagcaagagtccctggaa
aatgtctttgtacccccctcggaaacccttcatgcctcagctcctaactggcctccattc
aaagaagatgcagacaacatcctgtcgtgccacagcatcccagtgccagccacagaactg
ggctccactgagctggtgaccaccaagacagctggccctgagcagtag

DBGET integrated database retrieval system