KEGG   Rattus norvegicus (rat): 500911Help
Entry
500911            CDS       T01003                                 

Gene name
Serhl2, RGD1563386
Definition
(RefSeq) serine hydrolase-like 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr DUF676 Lipase_3 PGAP1 Abhydrolase_8 Abhydrolase_5
Motif
Other DBs
NCBI-GeneID: 500911
NCBI-ProteinID: NP_001124051
RGD: 1563386
Ensembl: ENSRNOG00000022932
UniProt: D4A071
Position
7q34
AA seq 310 aa AA seqDB search
MGLLSELKLAVPWGHIAVKVWGLQKNPPVLCLHGWLDNANSFDKLIPFLPKDFCYVAMDF
GGHGLSTHYSPGLPYYHHNFVSEVRRVVSAFKWTRLSLLGHSFGGVVGGLFACMFPEMVD
KLILLDSTPLLMDLNEVENIMTYRRKNIEQTLKVEDSQKPPGIFSPEEMLHELLTKNSHL
NEDCGELLLQRGTTKVAEGLVLNRDQRLSWPQYSFDFMGKELTMHSLRRLQASVLIIKAL
DGYYDVRRENDLNKASFLLMLDILRSTLKERFQFVEIPGNHYIHMNKPQIVADIIRSFLQ
GPPRTTPSRL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgggtttgctctcagagttgaagttggctgtgccctggggccacattgctgtcaaagtc
tggggcttgcagaagaaccctccagttctgtgcctgcatggctggttggacaatgccaac
tcctttgacaagctcattccttttcttccaaaagacttttgttatgtggccatggatttc
ggaggccatgggctttcaacccactacagcccaggtctcccctactaccaccataacttc
gtgagtgaggtccgaagggtggtgtcagcttttaagtggactcggctctccctcctgggc
cacagttttggtggcgttgtgggtggcttgttcgcctgcatgttccctgagatggtggac
aaactgatcttgctggactcgacgccacttctcatggacttgaatgaagtggagaacata
atgacctacaggcggaagaacatagagcagacactgaaggtggaagactcccagaagccc
ccgggcatcttcagcccagaggagatgctgcatgagctcctgactaagaacagccacttg
aatgaagactgtggggaactcctcctgcagaggggaaccacgaaggtggctgaaggtctg
gtgctgaacagggaccagaggctctcttggccacagtacagctttgacttcatgggcaag
gagctgactatgcactctttgaggaggctgcaggccagcgtgttaataatcaaagcactg
gacgggtactacgacgtgagacgggagaacgatttgaataaggcgtccttcctcctcatg
ctggacattctacgatccaccctaaaggagcggttccagtttgtggaaatcccaggcaat
cactacatccacatgaacaagccccagatcgtggctgacatcatccgctccttcctacag
ggcccaccgaggacaaccccttccaggctgtag

DBGET integrated database retrieval system