KEGG   Rattus norvegicus (rat): 500915Help
Entry
500915            CDS       T01003                                 

Gene name
Fam19a5, RGD1562115, Tafa-5
Definition
(RefSeq) family with sequence similarity 19 member A5, C-C motif chemokine like
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: TAFA
Motif
Other DBs
NCBI-GeneID: 500915
NCBI-ProteinID: NP_001178920
RGD: 1562115
Ensembl: ENSRNOG00000049349
UniProt: M0R7X9
Position
7q34
AA seq 132 aa AA seqDB search
MAPSPRTSSRQDATALPSMSSTFWAFMILASLLIAYCSQLAAGTCEIVTLDRDSSQPRRT
IARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCT
QPGGRIKTTTVS
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggcgccatcgcccaggaccagcagccggcaagatgcgaccgccctgcccagcatgtcc
tcaactttttgggcattcatgatcctggccagcctgctcatcgcctactgcagtcagctg
gccgctggaacctgtgagattgtgaccctagaccgggacagcagccagccacggaggacg
atcgcccggcagacagcacgctgtgcatgcagaaaggggcagatagcaggcaccacgcga
gcccggcctgcttgtgtggacgctcgaattatcaagacaaagcagtggtgtgacatgctt
ccttgcctggagggggaaggctgtgacttgttaatcaaccggtcaggctggacttgcaca
cagccaggagggcggataaagaccaccacggtctcctga

DBGET integrated database retrieval system