KEGG   Rattus norvegicus (rat): 500950Help
Entry
500950            CDS       T01003                                 

Gene name
Zfp317, RGD1565419
Definition
(RefSeq) zinc finger protein 317
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    500950 (Zfp317)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    500950 (Zfp317)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    500950 (Zfp317)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-C2H2_jaz Zn-ribbon_8 zinc_ribbon_15 zf-C2H2_11 zf-C2HE zf-met zf-C2H2_2 zf_UBZ HypA DUF3268 TRAF6_Z2 C1_4
Motif
Other DBs
NCBI-GeneID: 500950
NCBI-ProteinID: NP_001128106
RGD: 1565419
Ensembl: ENSRNOG00000006684
UniProt: D4A171
Position
8q13
AA seq 601 aa AA seqDB search
MATICLSPKFDNQESEFPLPSKCDSCHQSLSLFACRAPEPDTPAHVYSQEFVTFQDIAVD
FTEKEWPLLDSSQRKLYKDVMLENYSNLSSLGFQVGKPRLISHLEQEEELRMEERGIQQC
PSPDWETTSKIKWSILMEDIFGKEASDGVRLEASHLLEKSSDFTHLFEVLNIGRHLAQPI
GMPTSKRPYHHHTCGAAFKNRIHLTQHISMYDGRKMHECHQCQKAFTTSASLTRHCRIHT
GEKPYECSSCGKAFNDPSALRSHTRTHLKEKPFDCSQCGNAFRTLSALKIHMRVHTGERP
YKCDECGKAYGRSCHLIAHKRTHTGERPYECQDCGKAFQHPSHLKEHVRNHTGEKPFECI
QCGKAFRWKSNFNLHKKNHMVEKTYECKDCGKSFSDLLSRRKHMRSHIVKKPVECHQCGK
TFRNQSILKTHMNSHTGEKPYGCDLCGKAFSASSNLTAHRKIHTQERHYECSSCGKVFGD
YLSRRRHMSIHLVKKRVECRQCGKAFRNQSTLKTHMRSHTGEKPYECDHCGKGFSIGSNL
NVHRRIHTGEKPYECLVCGKAFSDHSSLRSHVKTHRGRSSLHHLCGKGFSEYSDAEETWQ
V
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggctaccatctgtctgtctcccaagtttgataaccaggaatcagaatttcctcttcca
tcaaaatgtgattcttgtcatcagagtttgagtttgtttgcttgccgtgctccagagcct
gatacaccagctcatgtttattctcaggagttcgtgacatttcaagatattgctgttgac
tttactgagaaagagtggcccctgctagattcttctcagagaaaactgtacaaagatgta
atgctggagaattatagcaatctaagttcattgggttttcaggttggcaaaccccgcctc
atctcacacctagagcaagaagaggagctgagaatggaggagagaggcattcagcagtgt
ccttctccagattgggaaactacatctaagatcaaatggtccattcttatggaagatatt
tttgggaaggaagcatctgatggtgtaagattggaagcatctcatcttttggagaaatca
tctgactttacccatttatttgaagtccttaatattggtcgtcaccttgcacagccaata
ggaatgcccacaagcaagagaccctatcaccaccacacctgtggagctgctttcaagaac
aggattcacctgactcagcacataagcatgtatgatgggagaaaaatgcatgaatgtcac
cagtgccagaaagccttcaccaccagtgcttctcttacaaggcactgtagaattcacact
ggggagaagccttatgagtgcagcagctgtggcaaagccttcaatgacccatcagctcta
aggagccacacaagaactcacctcaaagaaaagccctttgactgtagtcagtgtggtaat
gccttccggaccctctctgctctgaagatacacatgcgagttcacactggtgaaagaccc
tacaaatgtgacgagtgtggcaaagcctatggcaggagctgccacctcattgcccacaag
cgaacacacactggagagaggccctatgagtgtcaggactgtggaaaagccttccagcac
ccctcccacctgaaggagcatgttcggaaccatactggggaaaagccttttgagtgtata
cagtgtggcaaagccttccgatggaagtccaacttcaatttgcataagaagaaccacatg
gtggaaaaaacttatgagtgcaaagactgtggaaagtccttcagtgatctcctatcaaga
aggaaacacatgaggagtcacattgtaaagaaaccagtcgagtgtcatcaatgtgggaaa
acctttcgaaaccagtccatcctaaaaacacacatgaactctcacactggggagaaacct
tatggttgtgatctctgtggcaaagccttcagtgctagttccaacctcactgcacacagg
aagattcacactcaagagagacactatgaatgttcgtcctgtgggaaggtctttggtgat
tacctgtcacgaaggaggcacatgagcatccatcttgtcaagaagcgtgtggaatgtaga
cagtgtggaaaagcctttaggaaccaatctaccctgaagacacacatgagaagccacacc
ggtgagaagccatatgagtgtgaccattgcggaaaaggtttcagcataggatctaacctt
aatgttcatcggaggatccatactggggaaaagccttatgaatgtcttgtttgtggaaaa
gccttcagtgaccattcatcccttaggagtcatgtgaaaacccaccgggggagaagctct
ttgcaccatctctgtggaaaaggtttcagtgaatactcagatgcagaggaaacatggcaa
gtgtaa

DBGET integrated database retrieval system