KEGG   Rattus norvegicus (rat): 500959Help
Entry
500959            CDS       T01003                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00051  Fructose and mannose metabolism
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01230  Biosynthesis of amino acids
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00002  Glycolysis, core module involving three-carbon compounds
rno_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    500959
   00051 Fructose and mannose metabolism
    500959
   00562 Inositol phosphate metabolism
    500959
Enzymes [BR:rno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     500959
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   500959
  Exosomal proteins of bladder cancer cells
   500959
  Exosomal proteins of melanoma cells
   500959
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM GCM
Motif
Other DBs
NCBI-GeneID: 500959
NCBI-ProteinID: NP_001028244
RGD: 1560534
UniProt: Q6SA19
Position
8q13
AA seq 249 aa AA seqDB search
MAPSRKFFVGGNWKMNGKKKCLGELICTLNAAKMPADTEVVCAPPTAYIDFARQKLDPKI
AVAAQNCYKVTNGAFTGEISPGMIKDLGATWVVLGHSERRHVFGESDELIGQKVNHALSE
GLGVIACIGEKLDEREAGITDKVVFEQTKAIADNVKDWSKVVLAYEPVWAIGTGKTATPQ
QAQEVHEKLRGWLKCNVSEEVAQCTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPE
FVDIINAKQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcgccttccaggaagttcttcgtcgggggcaactggaagatgaacgggaagaagaaa
tgcctgggagaactcatctgcaccctgaacgcagccaagatgccggcagacaccgaggtg
gtttgtgcaccgccaaccgcctacatcgacttcgccaggcagaagctggatcccaaaatt
gctgtggctgcacagaactgctacaaagtgaccaatggggctttcactggggaaatcagc
cctggcatgatcaaagacttaggagctacctgggtggtgctgggacactcggaaagaaga
cacgtctttggggaatcagacgagttgattgggcagaaagtgaaccatgccctatccgag
ggactcggagtgatcgcctgcattggggagaagttagacgaaagggaagctggcatcact
gataaggttgtttttgagcaaaccaaggccatcgcagataatgtgaaggactggtccaag
gtggtcctggcctatgaaccggtatgggccattgggactggcaagactgcaacccctcaa
caggcccaggaagtacacgagaagctccggggatggctgaagtgcaacgtctctgaggag
gtggctcagtgcactcggatcatttatggaggttctgtgactggagcgacttgcaaagag
ctggcaagccagcctgatgtggatggcttcctcgtgggcggtgcatctctcaagcctgaa
ttcgtggacattatcaatgccaaacaatga

DBGET integrated database retrieval system