KEGG   Rattus norvegicus (rat): 500982Help
Entry
500982            CDS       T01003                                 

Gene name
Bsx, RGD1565120
Definition
(RefSeq) brain specific homeobox
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 500982
NCBI-ProteinID: NP_001178924
RGD: 1565120
Ensembl: ENSRNOG00000024438
UniProt: D4A5F6
Position
8q22
AA seq 232 aa AA seqDB search
MNLNFTSPLHPASSQRPTSFFIEDILLHKPKPLREVAPDHFASSLASRVPLLDYGYPLMP
TPTLLTPHTHHPLHKGEHHHPYFLATSGMPVPALFPHPQHAELPGKHCRRRKARTVFSDS
QLSGLEKRFEIQRYLSTPERVELATALSLSETQVKTWFQNRRMKHKKQLRKSQDEPKAAD
GPESPEGSPRAPEGAPADARLSLPAGAFVLTEPEDEVDIGDEGELSSGPHVL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcaacttcacttcccctctccatccagcatcttctcagaggcccacgtcgttt
ttcatcgaggacattctgctacacaagcccaagccgttgagggaagtggcccctgaccac
tttgccagctctctggcctctagggtgcctttgctagactatggctacccccttatgccc
acacccaccctcctcacccctcacactcatcatcctctgcataagggggagcatcatcac
ccttatttcctggccacctcagggatgccggtcccggctctgttcccgcacccgcagcat
gcagagctacccgggaagcactgccgccgccgcaaagctcgcacggtgttttctgactcg
cagctctccggcctggagaaaaggttcgaaatccagcgctacctgtcgacaccagagcgt
gtggagctggccactgctctcagcctctctgagactcaggtgaaaacgtggttccagaac
cggcggatgaagcataaaaaacagctgaggaaaagtcaagacgaacccaaagccgcagac
gggcctgagagcccagagggcagccctcgtgctcccgagggcgcgcccgccgacgctcgg
ctgagtttgccggccggtgccttcgtgcttacagagccggaggacgaggtggacattggg
gacgaaggcgagctcagctcagggccgcacgtgctctga

DBGET integrated database retrieval system