KEGG   Rattus norvegicus (rat): 500991Help
Entry
500991            CDS       T01003                                 

Gene name
Nxpe4, Fam55b, Fam55d
Definition
(RefSeq) neurexophilin and PC-esterase domain family member 4
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Neurexophilin Filamin DUF5605
Motif
Other DBs
NCBI-GeneID: 500991
NCBI-ProteinID: NP_001020226
RGD: 1560781
UniProt: Q5XI89
Position
8q23
AA seq 542 aa AA seqDB search
MKMMASRKSLWVLLFIVIFWISFTVFRNPVKLWAVFKLPASFNQWDLIMKSSCPKVPLNP
SVSPTETELRIREILEKLNKQIPPRPFAHLNNTTSATHSIATILNPQDTYCVGDQLDILV
EARDHLRNRKGYGGDFLRARMSSPALKAGASGKVTDFNNGTYLVSFTLFWEGQVSLSILL
MHPSEGVSALWRARNQGYDRIIFSGHFVSGASQVHTDCALVLNSSVELCQYLDAQDQEAF
YCVKPPNVPCAAITHMHSKNKDISYLSQQERSLFERSNIAVEIMGKSNVISVSKCNKAVP
VKKKCKFGMASAIPTGHVWKNTWNPASCSLAPIKMKDCLRGKLVHLMGDSTMRQWMEYFK
SKINTLRPVDLHETGRLQHQLAVDLDEKINIQWQKHGFPLIGSLVYSVKEIENTARIIDR
IGGEKNTVIVFSLGQHFRPFPIDVFIRRALSVHRALQRLLLRSPDTLVVLKTENTRELNN
DMERFSDFHGYTQYLALKNIFQDLRVGVIDAWDMTVAYGTNDVHPPEEVVRSEINIFLNY
IC
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgatggccagtcgtaagtcactgtgggtgctgctgtttatagtgatcttctgg
atctcttttaccgttttcagaaaccccgtgaagctatgggctgtgtttaagctgcctgca
tccttcaatcaatgggacttgatcatgaaatcctcatgccctaaagtgcctctcaatcca
tcagtttcaccaacagagacagagctgagaatcagggagatcctagagaaactaaacaaa
cagatccctcccagacccttcgcccacctcaacaacaccacaagtgctacacacagcata
gccaccatcctcaaccctcaagatacatactgtgtaggggaccagctggacatcctggta
gaggctagagaccacctaagaaacaggaaagggtatggtggggacttcctgagggccagg
atgtcttctccagccctgaaggcaggcgcttctggaaaagtgacagacttcaacaatggc
acctaccttgtcagcttcactctgttctgggagggccaggtctccctgtctatcctgctc
atgcaccccagtgaaggggtgtcagctctctggagagcaaggaaccagggttacgacaga
atcatcttctcaggccattttgtcagtggcgcttctcaggtccacaccgattgtgccctg
gttctaaattcaagtgtcgagctatgtcagtatctggatgcccaggaccaagaagctttc
tactgtgtgaagcctccaaatgtgccctgtgcggccatcacccacatgcattccaagaac
aaggacatttcttatcttagccagcaggaaaggagcctctttgaaaggtcaaatatagct
gtggagattatgggaaaatccaacgtgattagtgtctccaaatgcaacaaagccgtcccg
gtgaagaagaaatgcaagtttgggatggcatctgcaatccctactgggcatgtctggaaa
aacacgtggaatccggcctcctgcagtctggctccaatcaaaatgaaagactgcctgaga
ggaaaactcgtccatctaatgggtgattccacaatgcgccagtggatggagtacttcaaa
agcaaaatcaacacgctgaggccggtggacctccacgagactggaaggctgcagcaccaa
cttgccgtggacttggatgagaaaatcaacatccagtggcagaaacatggcttccctcta
atcgggtcattggtgtactctgtcaaagagatagagaacactgcacggataattgacaga
atcggaggagagaaaaacacagtcattgtcttttctctgggccagcatttcagacctttt
cccattgatgtttttatccgaagggccctcagtgttcacagagctcttcagcgtcttctc
ctgagaagcccggacaccctggtggtcctcaaaacagaaaacaccagggagttgaataac
gacatggagaggtttagtgacttccacggttacacccagtatcttgccttaaagaatatc
ttccaggatctccgtgtgggtgtcattgatgcctgggatatgacagttgcatatggcaca
aacgatgtccatccaccagaggaggtagttagaagtgaaattaatatattcttaaactat
atttgctag

DBGET integrated database retrieval system