KEGG   Rattus norvegicus (rat): 500995Help
Entry
500995            CDS       T01003                                 

Gene name
RGD1564937
Definition
(RefSeq) similar to RIKEN cDNA 1110032A03
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1143
Motif
Other DBs
NCBI-GeneID: 500995
NCBI-ProteinID: NP_001128108
RGD: 1564937
Ensembl: ENSRNOG00000030962
UniProt: D3ZGF3
Position
8q23
AA seq 179 aa AA seqDB search
MNMELPYKNPCSLKISSKSLYSPSSYTSIIQRQNLVCYLRNPHYGSLIYADGHGEVWTDW
NNMSKFSQYGWRCTTNENSYSDRTLIGNWNQERYDIKNVVQPKPLPSQFGHCFETTYDAS
YNSKKPQSTHRFKREPHWFPGHQPELDPPHYKCTEKSTSMNSYSKPQPTHYSWCVYDPK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggaactgccatataaaaatccctgctctctgaaaatttccagcaaatcactg
tattcaccatcaagttacacatcaataatacagagacaaaaccttgtctgttacctcaga
aacccacactatggcagccttatttatgctgatggtcacggtgaggtgtggacagactgg
aataacatgtccaagttttctcagtacggatggaggtgcaccactaatgagaactcgtat
tcggaccgtaccctgataggcaactggaaccaggaaagatatgatataaagaatgttgtg
cagcccaaacccttgccttcccagtttggacactgcttcgaaacaacatacgatgcaagc
tacaacagcaaaaagccacaatcaacacataggtttaaacgagagcctcattggttccct
ggacatcaacctgagctggatcctcctcattacaaatgcacagaaaagtcaacttctatg
aatagctactcaaagcctcaacccactcattactcttggtgtgtatatgatccgaaatga

DBGET integrated database retrieval system