KEGG   Rattus norvegicus (rat): 501002Help
Entry
501002            CDS       T01003                                 

Gene name
Tmem266, RGD1562084
Definition
(RefSeq) transmembrane protein 266
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: ThrE
Motif
Other DBs
NCBI-GeneID: 501002
NCBI-ProteinID: NP_001102764
RGD: 1562084
Ensembl: ENSRNOG00000015201
UniProt: D3ZYW8
Position
8q24
AA seq 529 aa AA seqDB search
MASPQPAIEGGISEVEIISQQVDEETKNIAPVQLVNFAYRDLPLAAVDLSTGGSQLLSNL
DEEYQREGSNWLKPCCGKRAAVWQVLLLSASLNSFLVACVILVVILLTLELLIDIKLLQF
SSAFQFAAVIHWISLVILSVFFSETILRIVVLGIWDYIENKIEVFDGAVIILSLAPMVAS
TVANGPRSPWDAISLIIMFRIWRVKRVIDAYVLPVKLEMEMVTQQYEKAKAIQDEHLERL
TQICQEQGFEIRQLRAHLAQQDLDLAAEREAALQAPHVLSQPRSRYKVVEAGTWAEETAA
ESIMEELRPSQEAMVKDDMNSYISQYYNGPSSDSGAPEPAVCVVTTAAIDIHQPNITSDL
FSVDLPLKLSGNSTCASATSETTSHPTCGSVTRAQSASSQTLGSSTDCSTPREELSSKPI
SSPLPLLLPPQQLVAEATVQDLMSSLSKDPCPSHKALDPAPLAQPTPVGSVQTSPELEHR
VSLFNQKNQEALPVLQIKPVIHLQPTAGLEEKFRSLESKEPKLHTVPET
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggccagtccacaacctgccattgaaggagggatttctgaagttgagattatctcgcaa
caagtagacgaagaaaccaagaacattgctccggtgcagctggtgaactttgcctaccgg
gacctgcccttggctgctgtagacctctccaccgggggctcacagctcctgtcgaatttg
gacgaagagtaccaaagagaagggtctaactggctgaagccgtgctgtgggaagagagcg
gccgtgtggcaggtacttttgctcagtgcaagtctcaacagtttcctggtagcctgtgta
atattggtggtgattctcctgactctggaacttctaatagatataaagcttctccagttt
tccagtgcattccagtttgctgctgtcattcactggatcagtctggtcattctctctgtg
ttcttctcagagactattctacggatcgtggtactggggatctgggattacatcgaaaac
aaaatagaggtgttcgatggggctgtgatcatcctgtccttggccccgatggtggcgtcc
actgtggctaacggacccaggagcccctgggatgccatcagtctcattatcatgttccga
atctggcgggtgaagagggtcattgatgcctatgtcctgccagtcaagttggagatggag
atggtcacccagcagtacgagaaggccaaggccatccaagacgagcatctggagagactg
acgcaaatctgtcaggagcaagggtttgagatccggcagctgcgtgcgcacctggcacag
caggacctggatctggcagcggagcgggaggcggcgctgcaggccccacacgtgctcagc
cagccacgcagccgctacaaggtagtggaggctggcacatgggccgaggagaccgcagcc
gagagcatcatggaggagctgaggccctctcaagaagccatggtgaaagacgatatgaac
agctacatcagccaatactacaacgggcccagcagtgacagtggagccccagaaccagca
gtgtgtgtggtcactacagctgccatagacatccaccagcccaatatcacctcagacctc
ttctcagtcgacctgcctctgaagctcagtggcaacagcacctgtgccagcgccacctca
gagaccacctcccaccccacctgtggctcagtcaccagggcccagagtgccagcagccag
acactgggttcctccacagactgtagcaccccccgagaagagctgtcctctaaacccata
tcttctcccctgccactgcttctgccccctcagcagctggtggcggaggccacagtccag
gacctgatgtcctctctgtcaaaggacccctgtccatcccataaggccttggacccagca
cccctggcccagcctactccagtgggctctgtccagaccagccctgagctggaacatagg
gtaagtctgttcaaccagaagaaccaggaggccctccctgttcttcagatcaagcctgtc
atccacttgcagcccacagctgggctggaggagaagttcagatctttggaatccaaagag
ccaaagttgcatacggttcctgagacctag

DBGET integrated database retrieval system