KEGG   Rattus norvegicus (rat): 501015
Entry
501015            CDS       T01003                                 

Gene name
C2cd4b, Fam148b, Nlf2
Definition
(RefSeq) C2 calcium-dependent domain containing 4B
Organism
rno  Rattus norvegicus (rat)
SSDB
Other DBs
NCBI-GeneID: 501015
NCBI-ProteinID: XP_001056441
RGD: 1591932
Ensembl: ENSRNOG00000009106
UniProt: D3ZDJ2
Position
8q24
AA seq 340 aa
MRLLGRLRSSTPEPAFSNVLTPGRIPEFCIPPRLPVPDAPESPLPAASLPWRCAAEPDLW
PRTHDGRENGDEDGAGLTDWDPRSQAALSLPHLPRARTVYGFCALLESPHTRRKESLFLG
HPGTPRLGFRHRAHTCAWQRRASDSELAAPRDLDTAPSVAPVPHVRRLLRAPDGLLSRAL
RVPRGRATARPGSRGDERERAASCAPPAPTGPDPERLQAEANVALGRGGCTLRLAAEYCP
RSACLRLRLLRAEGPAAELEPRALGCRLSLVLRPSGQQRASVVRRSRKAALDQDCCFDGL
PEEQLRRLAVRIKAESKGRGLERRRPLGQGELLLGSLLLL
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgaggcttcttggtcgactccgctcctccactcctgagcctgccttttccaacgtgctc
accccgggccgcatcccagagttctgcatccccccgcggttgcctgtgccggacgctccc
gaatcaccgctcccggccgcctcacttccttggcgctgcgcggccgaacccgacctatgg
ccacgcacccatgacggccgtgagaatggtgacgaagacggcgcgggcctcaccgactgg
gacccgcgctctcaggctgcgctctcgctgccgcacctgccccgggcgcgcacggtttac
ggcttctgtgcgctgctcgagagcccgcacacacgccggaaggagtcgctcttcctcggc
caccccggcacccctcggctggggtttcgccaccgtgcgcatacctgcgcgtggcagcgc
cgagcctcagattctgagctcgccgccccgcgcgatctggacacagccccatcagtcgct
cctgtgccccatgtgcgccgcctcttgcgcgctcccgatggtctgttgagccgcgcgctg
cgggtcccccgcggtcgggccaccgcgcgtcccgggtcccggggcgacgagcgcgagcgc
gccgcctcctgcgcgcccccagcccccaccggcccggatcccgagcgcctgcaggccgag
gccaacgtggctctgggccgcgggggttgcacgctgcgcctggcggccgagtactgtccg
cgcagcgcctgcctccgcctccgcctactgcgcgctgagggcccggccgccgagctcgag
ccccgcgccctgggctgtcgcctcagcctggtgctgcggccgtccggccagcagcgcgcc
agtgtggtccgccgcagccgcaaggccgccctggaccaggactgctgcttcgacgggctc
ccggaggagcaactgcgccgcctggcggtgcgcatcaaggccgagagcaagggccgcggg
ctggagcgcagacgaccactgggccagggcgagctgctgctgggctctctgctactgctc
tga

DBGET integrated database retrieval system