KEGG   Rattus norvegicus (rat): 501049
Entry
501049            CDS       T01003                                 

Gene name
Gpr62, RGD1560166
Definition
(RefSeq) G protein-coupled receptor 62
  KO
K08415  G protein-coupled receptor 62
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    501049 (Gpr62)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    501049 (Gpr62)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 501049
NCBI-ProteinID: XP_008756090
RGD: 1560166
Ensembl: ENSRNOG00000022567
UniProt: D4A2B1
Position
8q32
AA seq 358 aa
MASSSGLSVTELAGSVGFILAVLVEVGAVLGNGTLLVVVLRTPDLQDAFYLAHLCVVDLL
AAASIMPLGLLAAPPGLGSVPLDPSSCRAARFLSAALLPACTLGVAALGLARYRLIVHPL
RPGARPAPALVLTAVWSAAALLGALSLLGPPPAPPPAPARCSVLAGGLGPFRPLWAMLAF
ALPALLLLAAYGSIFLVARRAALRPPRGTRPRSDSLDSRLSFLPSLRPRLPGGKAALAPA
LAVGQFAACWLPYACACLAPAARAAAAEAAVTWVAYSAFAAHPFLYGLLQRPVRLALGRL
TRGVLPRAPKACTPQAWDLRTLLQRLQGLCKDPALGPSEAPEQNRELAGQSPRVSEAT
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggccagcagctcggggctaagcgtcaccgaactcgcgggctcggtggggtttatcctg
gcggttctcgtagaggtgggggccgtgctgggcaacggcactctgctcgtggtggtgctg
cgcacgccggacctgcaagatgccttctacctggcgcacttgtgtgttgtggacctgctg
gcggccgcctccatcatgcctctgggcctgctggctgcgccgcccgggctgggaagtgta
cccctggacccctcgtcgtgccgggcggcgcgtttcctctctgcagcactgcttcccgcc
tgcacgctcggcgtggccgctctcggcctggcgcgctaccgcctcatagtgcacccgctg
cggccaggcgcgcgcccggcgcccgcgctggtgctcaccgcggtgtggtccgcggccgcg
ctcctgggcgcactctccttgctcgggccaccgcccgcgccacctccagctccggctcgc
tgctccgtcctggccggggggctcgggcccttccggccactttgggcgatgctagccttc
gcgctccctgcccttctgctgctggccgcctacggtagcatcttcctggtggcgcggcgc
gccgctctccggcccccgcgcggtacccggccccgctccgactctctggacagccgcctc
tccttcttgccctccctccggccacgtctgcctgggggcaaggcggccctggccccagcc
ttggccgtgggccagtttgcagcctgctggctgccttatgcctgcgcgtgtttggcgccc
gcggctcgcgccgcagcggccgaggctgctgtcacctgggtagcctactccgccttcgcg
gctcacccctttctctatggtctgctgcagcgcccggtgcgcctggcgctgggccgcctc
acccgcggagtactacctcgggccccgaaagcttgcacaccgcaagcctgggacctgcgg
acactccttcagcgcctccagggactctgcaaggaccctgccctaggcccctcggaggca
ccagaacagaaccgagaattggctggacagagcccgagagtgtcagaggccacctga

DBGET integrated database retrieval system