KEGG   Rattus norvegicus (rat): 501069Help
Entry
501069            CDS       T01003                                 

Gene name
Golga4
Definition
(RefSeq) golgin A4
  KO
K20283  golgin subfamily A member 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    501069 (Golga4)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    501069 (Golga4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GRIP
Motif
Other DBs
NCBI-GeneID: 501069
NCBI-ProteinID: NP_001178009
RGD: 1591925
Ensembl: ENSRNOG00000029910
UniProt: A0A0G2K9I3
Position
8q32
AA seq 2213 aa AA seqDB search
MFKKLKQKISEEQQQLQQALAPAQASSSSSTPTRTRSRTSSFTDQLDDATPNRESGDTQT
FAQKLQLRVPSMESLFRSPIKESLFRSSKESLVRTSSRESLNQVDLDCAVATFDPPSDME
SEAEDAPWSSDSLSREQLLQRLRRMERSLSSYRGKYSELVTAFQTLQREKKKLQGILSQS
QDKSLRRISELREELQMDQQAKRHLQEEFDACVEEKDQYISVLQTQVSLLKQRLQNGPMS
VDVPKPLPPVELQAEAHSDMENPADAASPFVGGGTSAKTLEMLQQRVKRQENLLQRCKET
IGSHKEQCALLLSEKEALQEQLEERLQELEKMKELHMAEKTKLITQLRDAKNLIEQLEQD
KGMVITEAKRQMLETLELKDDEIAQLRSHIQRMTTQGEELREQKEKSERAAFEELEKALS
TAQKTEDAQRRMKVEMDEQIKAVERAGEEERLRLQHELSRVRQEAVSMAKKNSEQRADLQ
KLHAEQLASKEQELSQKLESRERELQEQMRMALEKSRSEYLKLTQEKEQQESLALEELEL
QKKAILTESENKLQGLRQEAEVHRTRIRELETSLEKSLQESRTQSERLAVHLEAEKSKHK
TELTALAEKHRTELEGLQQQQHSLWTERLQNLSQQHQAAVEELREKHQQEKDALLKEKES
LFQAHIQDMNEKTLEKLDKKQMELESVSSELSEALKARDQLAEELSVLRGDADQMKQALE
AELQEQRRHHQREVDSISGQQEIIVRRTEKALKDEISQLGGLLKEKDEHLQERQAQVHNL
EACLQKSAEELQQALAKLDLLQAQQSTTHAQTGAYEEQLAQMQQKVSDLETEKNLLTKQV
VEVETQKKRVCVELDAQRAQVQQLERQRSELEDKVKSLAQLQESQLKNSHVEKEQAQQIL
TEKENVILQMREEQAKEIEILKQKLFSKEESISILHEEYETKFKNQEKRMEKIKQKAKEM
QEMKKKLLDQEAKLKKELENTVLELSQKEKQFNAKILEMAQANSAGISDTVSRLEENQRQ
QIESLTGAHQRELDDLIESWEKKLSQQAEELRDQHEKLIEEKEQELGELKQKVLTVQSEK
EEVTQEVARLTEAVTGQDVTLAGLQGQLEQKSAAVLALSDSHAQLQSQVEKLEVDLGCAL
NEKLSLQEELAELKMLAEREKLRVSELTGKVQAAEEELQSCKSLHEVSRKSLEDKSLNLR
TLLEELASQLDRHCERTKALLEAKTNELVCTSRDKADAILARLSRCQRHTATVGEALLRR
MGQVSELEAQLTQLTEEQCTLKNSFQQVTNQLEEKENQIKTMKADMEGLIAEKEALQQEG
GQQQQVASEKESCITQLKKELSENINAVTLLREELSEKKSEIASLSKQLSDVSAQLENSI
SPSDKAEAISALSKQHEEQELQLQAQLRELSSKVDALSKEKMSALEQVDHWSNKFSEWKK
KAQPRFAQYQSTIKDLQTQLDLKAKEAGEKDEQIRLLKEDLDQQNERFESLKGEMEKKEC
DLETELKTRTARVVELEDCITQRKKEVESLNEALRNCSQQRDTEHSGLVQTLQRLEELGQ
EKDNKVREAEETVLGLRERVSSLEAELRVVRKELDDVNSSVKSRDGELKALEDKLELESA
AKVELKRKAEQKLAAIRKQLLSQMEAKVQQCAKDTESQLSELRAKLQGREKQIHILEGKL
KNLASSPHPERAVVSGSMGNVAASPEQEAADSQECTQKACKERVCVLQRSVIEKERLTQR
LQQGEREAAPSQSEVRHRELSVKLDRARAKQLEDQVLIGCLQEELEERMKCPSILSQPMG
EETGKNNTGLKQNWASMVDTVQKTLQEKELSCQALERRVRELESDLITERDAHRLEVEKL
TLKYEKSQSPQQEMGGKNTSVEILEDRPEENSKSHVIESKLGTPMDGRHSDLESKLAGSE
REKQKLSKEVGRLQKDLRALRKEHQQELDILRKECEQEAEEKLKQEQEDLELKHSSTLKQ
LMREFNTQLAQKEQELERTVQETIDKAQEVEAELLQSHQEETQQLHRKIAEKEDDLQRTA
RRYEEILDAREEEMTAKVMDLQTRLEELQKKYEHRLEQEESAKDSVTVLELQTQLAQKTT
LISDSKLKEQELREQVHNLEDRLKSYEKSVCAAAVGAPYRGGNLYHTEVSLFGEPTEFEY
LRKVLFEYMMGRETKTMAKVITTVLRFPDDQAQKILEREDARLMFTSPRSGIF
NT seq 6642 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagaagctgaagcagaagatcagcgaggagcagcagcagctgcagcaggcgcta
gcccctgctcaggcttcctccagctcttcaacaccaacaaggactagaagcaggacatct
tcatttacagaccagcttgatgacgcaacacccaacagagagtcaggtgacacacagact
tttgcacagaagctgcagctccgagtgccttctatggagtctctgtttcgaagtcccata
aaggaatccctgtttcggtcttctaaagagtctttggtccggacatcttccagagagtcc
ctgaaccaagttgacctggactgtgctgttgccacctttgatccaccttctgatatggag
agcgaggctgaagatgctccgtggagctcagacagcctcagcagagagcagctgctccag
cgcttgcgcaggatggagcggagcctgagcagctaccgagggaagtactccgagctggtc
acagcgtttcagactcttcagagagagaagaaaaagctacaaggtatattgagtcagagt
caagataaatcacttcggagaatttcagaattaagagaggagctgcaaatggaccagcaa
gcaaagagacacctgcaggaggagtttgacgcctgtgtggaggagaaggaccagtacatc
agtgttctccagactcaggtttctcttctaaagcaacgattacagaatggcccaatgagt
gttgatgttccaaaaccactccctccagtggagctccaggcagaagcgcacagtgacatg
gagaaccctgctgatgctgcttcaccgtttgtaggaggtgggacgtctgctaaaaccctg
gagatgctccagcagagagtgaaacgtcaggagaatctgcttcagcgctgtaaggagaca
atcgggtcccataaggagcagtgcgcactgctgctgagcgagaaggaggcactgcaggag
cagttggaggaaaggctgcaggagctggagaagatgaaggagcttcatatggctgagaag
actaaacttatcactcagttgcgtgatgcaaagaacttaattgaacagcttgaacaagat
aagggaatggtaataacagaggcgaagcggcaaatgcttgagaccctggaactgaaagac
gacgaaattgcccagcttcgtagtcatatacagcggatgactacccagggagaggaactg
cgggagcagaaggaaaagtctgaaagagctgcttttgaggaactcgaaaaagccttgagt
acagcccaaaaaactgaagacgcacagagaagaatgaaggtggagatggatgagcagata
aaggctgttgagagagcgggcgaggaggagcgcctccgccttcagcacgaactcagtcgg
gtgaggcaggaggctgtcagcatggcgaaaaagaactcagagcagcgcgctgaccttcag
aagctgcatgcggagcagttggccagcaaagagcaggagctgagccagaagctggagagc
cgggagagggagctgcaggagcagatgaggatggccctcgaaaagagtcgatcagaatat
ttgaagctcacccaagaaaaagagcagcaagaatccttggctttagaggagttagagctg
cagaaaaaagccatacttacagagagtgaaaataaactgcagggacttaggcaagaagca
gaggtgcaccgaaccagaattcgtgagttggaaacgtctttggaaaaaagcttacaagaa
agcagaactcagtcggagcgcttggctgttcatctggaagctgagaagagcaagcacaaa
acagagctcacggccctggcggagaagcacaggacagaactggagggcctccagcagcag
cagcacagcctgtggaccgagagactccagaacctctcgcagcagcatcaggctgctgtg
gaggagctcagagagaagcatcagcaagaaaaggatgcattactgaaggagaaggagagt
ctcttccaggcccacatacaagacatgaatgaaaagaccttggagaagctcgacaagaag
caaatggaactggaatctgtgtcttctgagctgtcagaagcactgaaagcccgggaccag
cttgcagaggagctttctgtcctaaggggggacgcagatcaaatgaagcaggctttagag
gccgagctgcaggagcaaaggcgtcaccaccagcgtgaggttgacagcatcagtgggcaa
caagaaataatcgtccgcagaaccgagaaggcactgaaagatgagatcagtcagctgggg
gggctcctgaaggagaaggacgagcacctccaggagcgtcaggcccaggtacacaatctt
gaagcttgtcttcagaagtctgctgaggagctccagcaggccttggccaagctggacctc
ctccaggctcagcagagcaccacacatgcgcagacaggcgcatatgaggagcagctggcc
caaatgcagcaaaaggtgtcggacctggaaacagagaagaaccttctgaccaagcaggtg
gttgaagtggaaacacagaagaagcgtgtgtgtgtggaattggacgctcagagagctcag
gtccagcagctcgagagacagaggagtgaactggaggacaaggtcaaatccttagcccag
ctccaggagtctcagctcaagaacagccatgtggagaaagagcaagcacagcagatcctg
acggaaaaggaaaatgtcattttacagatgcgagaagaacaggccaaggaaatcgagatc
ctcaaacagaaattgttttctaaagaagagagcattagtattttacacgaggaatatgaa
accaaatttaaaaatcaggaaaaaagaatggaaaaaattaagcagaaagcaaaagaaatg
caagaaatgaagaaaaagttgttggatcaggaagccaagcttaaaaaagagcttgaaaat
actgtcctagagcttagtcagaaagagaagcagttcaatgccaaaatcctggaaatggca
caggctaactcggctggaattagcgacacggtgtcgagactagaggagaaccagaggcag
cagatagaaagcctgaccggggctcatcagcgagaactggatgatctcatagagtcctgg
gaaaagaaactcagtcagcaggctgaagagcttcgggaccagcatgagaagctgatagag
gagaaggagcaggagcttggggagctgaagcagaaggtcctcacagtccagtctgaaaaa
gaggaggtgactcaggaagtggcgcgcctgacagaggcagtcactgggcaggacgtgacc
ctagctggcctgcaggggcagctggagcagaagtctgctgccgtcctcgctctttcagac
agtcacgctcagttgcagtcacaagtggaaaagctggaagttgatttgggttgtgctctg
aatgaaaagctttctcttcaagaggagctggctgagctgaaaatgctggcagagagggag
aagctcagggtctctgagctgactggcaaggtgcaggctgcagaggaggagctccagagc
tgtaagtccttacatgaggtcagcaggaagagcttggaggacaaaagcttgaacctcaga
accttgcttgaggagctagcatctcagctagaccgtcactgtgagagaactaaagctttg
ttagaagccaaaacaaatgaactagtctgcaccagccgggacaaagctgacgctattctc
gccaggctgtcccgctgccagcggcacacagccacagttggggaagccctgctcaggaga
atgggccaagtttctgaattagaagcacaacttacacagttgacagaggagcagtgtaca
ctaaagaactcttttcagcaagttactaatcaattggaagaaaaagaaaatcagattaag
accatgaaggccgatatggaaggtcttatcgcagaaaaagaagccttacagcaagaagga
ggtcagcagcagcaggtggcctctgagaaggagtcgtgtatcacacagttgaagaaggag
ttgtcagagaacatcaatgctgtcacactactgagagaggaactctccgagaagaagtct
gagatcgccagtcttagcaagcagctaagtgacgtcagtgctcagctggagaacagcatc
agcccgagcgacaaggccgaggccatctctgcactgagcaagcagcatgaggaacaagag
ctgcagctgcaagctcagcttcgggagctgtcttcaaaagtcgatgctctgagtaaggag
aaaatgtctgccctggagcaggtagatcattggtccaacaagttctcagagtggaagaag
aaagcacagcccagatttgcacagtaccaaagcacgattaaagacctgcagacacagctt
gacctaaaagccaaagaagctggtgagaaggatgagcagatacgcttgttgaaggaagac
cttgatcagcagaatgaaagatttgaaagtttaaagggcgagatggagaaaaaggagtgt
gatctagagactgagttaaagactcggacagccagggtcgttgaattagaagactgtatt
actcagaggaaaaaagaagtagagtccctaaatgaagccctcaggaattgcagccagcag
agggacactgagcacagtggcctggttcagacactgcagcgcctggaagagctggggcaa
gagaaagacaacaaggtcagggaggctgaggagacggtcctggggctgcgggagcgcgtg
tcctcgctggaagctgaactccgcgtcgtgaggaaggaactagacgacgtgaattcaagt
gtgaaaagcagagacggggagctgaaagcgttagaagacaaacttgagttagaaagtgct
gcaaaagtggagctgaagaggaaggcggagcagaagctcgccgccatccggaagcagctc
ttgtctcagatggaggcgaaggtgcagcagtgtgcgaaggacacagagagccagctgagt
gagctgcgtgcaaagttacagggcagagaaaagcaaatccacatcctagaaggaaaactt
aaaaacctagcaagttccccacacccagaaagagcagttgtgtcaggatccatgggaaac
gtggcagcgtctcctgagcaagaggcagcagattcccaagagtgcacacagaaggcatgc
aaggagcgagtctgcgtgctgcagagaagtgtgattgagaaagagaggctgacacagagg
ctgcagcagggcgaacgggaggcggcgccatcgcagtctgaggttcggcacagggagctc
tccgtgaagttagatcgcgccagagccaagcagctcgaggatcaggttttgataggatgt
cttcaagaagaactggaagaaaggatgaagtgtccctcaattctgtcccagcccatggga
gaagaaaccggtaaaaacaacacagggctgaagcagaattgggcaagtatggttgacact
gtccagaaaacgctccaggaaaaggagctgagctgccaggccctggagcgaagggtgaga
gagctggagtcagacttaataacagagagggacgcccataggcttgaagtggaaaagttg
accttaaaatatgaaaaatcacaatctccacagcaagagatgggtgggaaaaatacgtct
gtggaaattttggaagacaggcctgaggaaaattccaaatcccatgtgatagaatcgaaa
ctggggacccccatggacggccggcacagtgacctggagtcgaagttagcagggtcagag
cgggaaaagcagaagctgagcaaggaggtggggaggctgcagaaagatctccgagctctg
agaaaggagcatcagcaggagctggacatcctgaggaaggaatgtgagcaggaagcagag
gaaaagctcaaacaggagcaagaggatcttgagttgaagcacagctccacactgaagcag
ctgatgcgggagtttaacacccagctggcacagaaggagcaggagctggagagaactgtc
caggagaccatcgataaggcccaagaggtggaagctgaacttctgcaaagccaccaagaa
gagacacagcagctgcatagaaagattgcggagaaagaggatgatctgcaaaggacggcc
agaagatacgaggagatacttgatgcccgggaagaagaaatgactgcaaaagtaatggac
ctgcagacccggctggaggagctccagaagaaatacgagcacaggctagagcaggaggag
agcgccaaggacagtgttacagttctggagctacagacacagctggcccagaagaccacc
ctgatcagcgattccaagctgaaggagcaggagttgagagagcaggtccataatttagaa
gaccgtttgaaaagctatgagaagagtgtatgtgcagcagctgtgggggcaccttacaga
ggaggcaatttgtaccacactgaggtctcactcttcggagaacctactgagttcgaatat
ttgcgaaaagtgctgtttgaatatatgatgggtcgagagaccaagaccatggccaaagtt
ataactactgtcctaagattccctgatgatcaagctcagaaaattttggaaagagaagac
gctcggctgatgttcacctcacctcgcagtggcatcttctga

DBGET integrated database retrieval system