KEGG   Rattus norvegicus (rat): 501083
Entry
501083            CDS       T01003                                 

Gene name
Pdcd6ip, AIP1, Alix, RGD1561176
Definition
(RefSeq) programmed cell death 6 interacting protein
  KO
K12200  programmed cell death 6-interacting protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    501083 (Pdcd6ip)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    501083 (Pdcd6ip)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    501083 (Pdcd6ip)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT associated proteins
    501083 (Pdcd6ip)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   501083 (Pdcd6ip)
SSDB
Motif
Pfam: BRO1 ALIX_LYPXL_bnd AAT
Other DBs
NCBI-GeneID: 501083
NCBI-ProteinID: NP_001025081
RGD: 68357
Ensembl: ENSRNOG00000008981
UniProt: A0A140TAA4
Position
8q32
AA seq 868 aa
MASFIWVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRSALGRPLDK
HEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEK
SCVLFNCAALASQIAAEQNLDNDEGLKTAAKQYQFASGAFLHIKDTVLSALSREPTVDIS
PDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDALPKE
VFPTLAAKQCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKNVASRYDEYVNVKDF
SDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKPTPVNVPISQKFTDLFEKMVP
VSVQQSLAVFSQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTK
STAVVEQGGIQTVDQLIKELPELLQRNREILEESLRLLDEEEATDNDLRAKFKDRWQRTP
SNDLYKPLRAEGAKFRAVLDKAVQADGQVKERYQSHRDTIALLCKPEPELNAAIPSANPA
KTMQGSEVVNVLKSLLSNLDEIKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALS
VTELDRIYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNSEASLREEVLKNLATAY
DNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERDELLKDLQQSIAREPSAP
SIPPPAYQSSPAGGHATAPTPAPRTMPPAKPQPPARPPPPVLPANRVPPAAAATAPAGVG
TASAAPPQTPGSAPPPQAQGPPYPTYPGYPGYCQMPMPMGYNPYTYGQYNMPYPPVYHQS
PGQAPYPGPQQPTYPFPQPPQQSYYPQQ
NT seq 2607 nt   +upstreamnt  +downstreamnt
atggcgtcgttcatctgggtgcagctgaagaagacctcggaggtggacctggccaagccg
ctggtcaagttcatccagcagacgtacccgagcggcggcgaggagcaggcccagtactgc
cgcgcggccgaggagctcagcaagctgcggcgctcggcgctcggccgcccgctggacaag
cacgagggcgcgctggagacgctgctgagatattatgaccagatttgttctattgaaccc
aagttcccattttctgaaaatcagatctgcttgacatttacgtggaaggatgcttttgat
aaaggttccctttttggaggatctgtaaaattggctcttgcaagcttaggatatgaaaag
agctgtgtgttgttcaactgtgctgccttagctagccagatcgcagcagagcagaacctg
gataatgatgaaggactgaaaaccgctgctaagcagtaccagtttgctagtggtgccttt
ttacatattaaagacacagttttatctgccttaagtcgagagcctactgtggacatatct
ccagatactgtggggaccctcagtcttattatgctggcccaagctcaagaagtatttttc
ttaaaagccacaagagataagatgaaggatgccatcatagcgaagctggccaatcaggct
gccgattactttggcgatgctttcaaacagtgtcagtacaaagatgccctccccaaggag
gtattccctaccctggctgcaaagcagtgcatcatgcaggctaatgctgagtaccaccag
tccatcctggccaagcagcagaagaagtttggggaagagatcgcaaggttgcagcatgca
gcagaactgattaagaatgtggcctctcgctatgatgaatatgtcaatgtgaaggatttt
tctgacaaaatcaaccgtgccctggctgcagcaaagaaggataatgattttatttatcat
gaccgtgttccggaccttaaggatctggatcctattggcaaagccacgcttgtgaaaccc
actccagttaatgtacccatcagccagaagttcacggatttgtttgagaagatggtgcct
gtgtctgtgcagcagtccctggctgtgtttagtcagaggaaagctgacttggttaacaga
tcaatcgctcagatgagagaagctacaactttggcaaatggagtactggcttcccttaac
cttccagcagcaattgaagatgtgtctggagacactgtacctcagtctatacttaccaag
tccacagctgtagtcgagcagggaggcatccagactgtcgaccagctgataaaagagctg
cctgagctgctacaaagaaatagggaaatattagaggagtcactaagattgttggatgaa
gaagaagcaactgataatgacttaagagcaaaattcaaggaccggtggcaaaggactcca
tccaatgacctgtacaagcctttacgagcagagggagccaagttcagagccgttttagat
aaagcggtgcaagcggatggacaggtgaaggagcgctaccagtcccaccgagacaccatc
gcccttctgtgtaagccagagccggagctgaatgccgccatcccttctgctaacccagca
aagaccatgcagggcagtgaggttgtaaatgtcttaaaatccttattatcaaatcttgat
gaaataaagaaggaaagagagggtcttgagaatgacctgaagtcagtgaattttgacatg
acaagcaagtttttgacagctctggcccaagatggcgtgataaatgaggaggctctttct
gtcactgagctggatcggatctatggtgggctaacaactaaagttcaagagtctctgaag
aaacaggagggacttctaaaaaatatacaggtctcacaccaggaattctccaaaatgaag
cagtctaacagtgaggccagcctgagggaagaggtcctgaagaacttagcgaccgcgtac
gacaacttcgtggagctcgtagctaacttgaaagagggcacaaagttttacaatgagctg
actgaaatcctggtcaggttccagaacaaatgcagtgacatagtgtttgcacggaagacg
gaaagagatgagctcttgaaggatctgcagcagagcattgccagagagcccagcgctcct
tctatccctccgccagcatatcagtcctccccagcagggggacatgcgacagctccaact
ccagctccaagaaccatgccgcctgctaagccccagcctccagcccggcctccacctcct
gtgcttcctgcaaaccgagttcctcctgctgctgccgctactgcccctgcaggggtgggg
actgcttcagcagcaccgccacagacccctggctctgctccccctccacaggctcaggga
ccaccgtatcccacctatccaggatatcccgggtattgccaaatgcccatgcccatgggc
tacaacccctacacatatggccagtacaatatgccgtacccaccggtgtatcaccagagc
cctggacaggctccgtacccaggaccccagcagcctacctaccccttccctcagcccccg
cagcagtcatactatccacagcagtaa

DBGET integrated database retrieval system