KEGG   Rattus norvegicus (rat): 501088Help
Entry
501088            CDS       T01003                                 

Gene name
Tbc1d5, RGD1561626
Definition
(RefSeq) TBC1 domain family, member 5
  KO
K18469  TBC1 domain family member 5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    501088 (Tbc1d5)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    501088 (Tbc1d5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RabGAP-TBC Med3 Spt20 Apt1 Suf
Motif
Other DBs
NCBI-GeneID: 501088
NCBI-ProteinID: NP_001128234
RGD: 1561626
Ensembl: ENSRNOG00000010637
UniProt: F1M9Q1
Position
9q11
AA seq 805 aa AA seqDB search
MYKSVSETRHPLQSEEQEVGIDPLFSYSNKPRGDSCQNGRGANSNLDCDGTFSSYMREWD
DLFVNNNYLAAVRQKGINGQLRSSRFRSICWKLFLCVLPQDKSQWISRIKELRSWYSNIK
EIHITNPRKVVGQQDLMINNPLSQDEGSLWNKFFQDKELRSMIEQDVRRTFPEMQFFQQE
NVRKILTDVLFCYARENEQLLYKQGMHELLAPIIFTLHCDHQAFLHASESAQPSEEMKTL
LNPEYLEHDAYAMFSQLMETAEPWFSTFEHDGQKGKETLMPPIPFARPQDLGPTVAIVTK
VNQIQDHLLKKHDTELYMHLNRLEIPPQIYGLRWVRLLFGREFPLQDLLVVWDALFADGL
HLSLVDYVFTAMLLYIRDALISSNYQTCLGLLMHYPLIGDIHSLILKALFLRDPKRNPRP
VTYQFHPNLDYYKARGADLMNKSRTNARGAPLNIHKVSNSLINFGRKLIAPASAPGSMGG
PVPGSNSSSSFSAAVPFRTSAEAPRHHSQQQRQQQQQQQQQQQQQQQQQQQRLMKSESMP
VQLNKGQSPKTISSSPSMESLPGGREPPGSPPSSATKRDSFFSHIARSRSHSKAMGRKES
EEELEAQISFLQGQLNDLDAMCKYCAKVMDMHLVNIQDVVLQENLEKEDQILVSLAGLKQ
IKDILKGSLRFNQSQLEAEENEQITIADDHYCSSGQDQGTQGPRAAKQASSEMPGCTGGA
TSDDFILVSKEDEGRRAKEAFSGQAQPLLTLRNTSGKSRVPTCSPLVFSDPLMGPASASS
SNPSSSPDDDSSKDSGFTIVSPLDI
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgtataagtctgtgtctgaaactagacatcctctgcagtcagaagaacaagaagtaggc
attgaccccttgttcagttattcaaacaagccaagaggagattcctgtcaaaatggaaga
ggagcaaattccaacttagactgcgacgggactttcagttcatatatgagagagtgggac
gacctctttgtaaataacaactacttggcagcagtgaggcagaaggggattaatgggcag
ctgagaagcagcaggttccgcagcatttgttggaagctctttctttgtgttcttcctcaa
gataaaagtcaatggatcagtagaattaaagaactaagatcctggtatagcaatattaaa
gaaatacatatcactaatccaaggaaagttgttggccaacaggatctgatgataaacaat
cccctctcacaagatgaaggaagtctttggaataagttctttcaagataaagagctgcgg
tccatgattgagcaagatgtcagaagaacgtttcctgaaatgcagtttttccaacaagaa
aatgtgagaaaaattcttacagatgttctgttctgctatgctagagaaaacgagcagttg
ctttataaacagggcatgcatgagctgctagcgcccatcatcttcacccttcactgtgac
caccaagcttttctacacgccagtgagtctgcacagcccagtgaggaaatgaaaactctc
ttgaaccctgagtatctggagcatgatgcctatgcaatgttctcacagcttatggaaact
gctgaaccttggttttccacttttgagcatgatggtcaaaagggaaaagaaactctgatg
ccccccattccctttgctcgaccacaggatttaggaccaacagttgccattgttacaaaa
gtcaaccagatccaggatcatctactgaagaagcatgatactgagctctacatgcacttg
aacagactagaaattccaccacaaatatatgggttacggtgggtgcggctgctgttcggc
agagagttccctctacaggacctgctggtggtctgggatgccctgtttgcggacggcctc
cacctgagtctagttgactatgtcttcacggccatgctgctctacatccgagacgctctg
atttctagtaactatcagacctgtctcggccttttgatgcattatccactcatcggggac
atacactcactgatactgaaggccctgttccttagagacccaaagagaaaccccaggcca
gtgacttaccagttccaccccaatttagactactacaaagcacggggagctgaccttatg
aacaaaagccggaccaatgccagaggtgctcctctgaatatacacaaggtctccaacagc
ttgattaactttggaagaaagttgattgccccggcctcagctccaggcagtatgggtggc
cctgtgcctgggagcaacagcagcagctctttctctgctgccgtccccttcaggacctcc
gcagaagccccgaggcatcattctcagcagcagcggcagcagcagcagcagcagcagcag
cagcagcagcagcagcagcagcagcagcagcagcggttgatgaagtctgaaagcatgccg
gtacagttgaacaaagggcaaagtccgaaaaccatcagttcatctccgagtatggagagt
ttgcccgggggaagagaaccccctggctccccgccttcatctgctaccaaaagggattcc
tttttcagccacatcgcccgctcccgctcacacagcaaagccatgggcagaaaagaatct
gaagaagaattagaagcccagatttccttcctacaaggtcagctgaatgacctggatgcc
atgtgcaagtattgcgcaaaggtcatggacatgcatcttgtaaatattcaagatgtggta
ttacaagagaatttggaaaaagaagatcaaattctggtgtccttggcaggattaaaacag
atcaaagacattctgaaaggttccctgcgcttcaaccagagccagctggaggctgaagag
aacgaacagattaccatcgctgatgaccactactgctccagtggccaggaccagggcacc
caaggccctagggccgccaagcaggcctcttcagagatgccagggtgcacaggtggagcg
acctcagacgacttcattctggtttctaaagaagatgaggggcgccgtgcgaaggaggcc
ttctcaggccaggcccagcccctgctcaccctcagaaacacgtctgggaaaagtcgagtc
ccaacctgctccccactggtgttctcagacccactgatgggcccagcctcagcctcctcc
agcaaccctagctccagcccagatgatgacagcagcaaggactctggcttcaccatcgtg
agccccttggacatctga

DBGET integrated database retrieval system