KEGG   Rattus norvegicus (rat): 501099
Entry
501099            CDS       T01003                                 

Gene name
Srf, RGD1559787
Definition
(RefSeq) serum response factor
  KO
K04378  serum response factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04022  cGMP-PKG signaling pathway
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    501099 (Srf)
   04022 cGMP-PKG signaling pathway
    501099 (Srf)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    501099 (Srf)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    501099 (Srf)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    501099 (Srf)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box responders to external signals
    501099 (Srf)
SSDB
Motif
Pfam: SRF-TF
Other DBs
NCBI-GeneID: 501099
NCBI-ProteinID: NP_001102772
RGD: 1559787
Ensembl: ENSRNOG00000018232
UniProt: D3ZHH8
Position
9q12
AA seq 504 aa
MLPSQAGAAAALGRGSALGGSLNRTPTGRPGGSGGTRGANGGRVPGNGAGLGPGRLEREA
AAAAAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMELGVVVGGPEAAAAAAGGY
GPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVL
LLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPSTDQRMSATGFEEP
DLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPITNYLA
PVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGAVAQQVPVQAIHVHQ
APQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPTSGLA
DGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTAPSGTVQIPVSAVQLHQMAVIGQQ
AGSSSNLTELQVVNLDATHSTKSE
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgttaccgagccaagctggggccgcggcggctctgggccggggctcggccctggggggc
agcctgaacaggaccccgacggggcggccgggcggcagcggtgggactcgcggggcgaac
gggggccgggtccccgggaacggcgcggggctcggcccgggtcgtctggagcgggaggct
gcagcagcagcagcgcccaccgccggggccctctacagcggcagcgagggcgactctgag
tccggcgaggaggaggagctgggcgccgagcggcgcggcctcaagcggagtctgagcgag
atggagctcggtgtggtggtcggtgggcctgaggcggcggcggcggccgccggaggctac
ggaccggtgagcggcgcggtgagcggggccaagccggggaagaagacccggggccgcgtg
aagatcaagatggagttcatcgacaacaagctgcggcgttacacgaccttcagcaagagg
aagacgggcatcatgaagaaggcttatgagctgtccacgctgacagggacacaggtgctg
ttgctggtggccagtgagacaggccatgtgtatacctttgccacccgcaaactgcagccc
atgatcaccagtgagaccggcaaggcgctgattcagacctgcctcaactcgccagactct
ccaccccgctcagaccccagcacagaccagagaatgagtgccactggctttgaagagcca
gatctcacctaccaggtgtcggaatctgacagcagtggggaaaccaaggacacactgaag
ccagcattcacagtcaccaacctgccgggtaccacctccacaatccaaacagcacccagc
acctctaccaccatgcaagtcagcagcggcccctccttccccatcaccaactacctggca
ccagtgtctgctagtgtcagccccagtgctgtcagcagtgccaacgggactgtgctcaag
agtacaggcagcggccctgtctcctctgggggccttatgcagctgcctaccagcttcact
ctcatgcctggtggggcagtggcccagcaggtccctgtgcaggccattcatgtgcaccag
gccccacagcaagcgtctccctctcgtgacagcagcacagacctcacgcagacctcctcc
agcgggacagtgacgttgcccgccaccatcatgacgtcgtctgtacccacaactgtgggt
ggccacatgatgtaccctagtccccatgcagtgatgtatgcccccacctcgggcctggct
gatggcagcctcaccgtgctcaatgccttctctcaggcaccatccaccatgcaggtgtcc
cacagccaggtccaggagccaggtggtgtccctcaggtgttcctcacagcaccgtctggg
accgtgcagatccctgtctctgccgttcagcttcaccagatggctgtgataggacagcaa
gctgggagcagcagcaacctcaccgagctacaggtggtgaacttggacgccacccacagc
accaagagtgaatga

DBGET integrated database retrieval system