KEGG   Rattus norvegicus (rat): 501158Help
Entry
501158            CDS       T01003                                 

Gene name
Spag16, RGD1565062
Definition
(RefSeq) sperm associated antigen 16
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160
Motif
Other DBs
NCBI-GeneID: 501158
NCBI-ProteinID: NP_001128200
RGD: 1565062
UniProt: B0BMX7
Position
9q33
AA seq 310 aa AA seqDB search
MQPDPNLTACTESLPTAKFDYRLNNIFRLHELPVSCIVMHPFRDYLVSCSEDRLWKMVGL
PKGNVILTGSGHSDWLSDCCFHPSGSKLATSSGDSTIKLWDLSKGECILTFAGHNHAIWS
CTWHSCGDFVASASLDMTSKIWDVNSERCRYTLYGHTDSVNSIEFFPFSNTLLTASADKT
LSVWDARTGKCEQSLYGHMHSVNDATFTPRGHILASCDSRGVIKLWDFRKLIPIVSIDVG
PSPGNEVNFDPSGRVLAQASANGIIHLLDLKSGQIHKLVGHESEVHTVIFSHRAENLYSG
GSDGTIRLWL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcaacctgatccaaacttgactgcatgtacagagagccttccgactgcaaaatttgac
tacaggctaaacaacattttcagacttcatgaactcccagtgagctgtatcgtcatgcac
cccttcagagactatctggtctcctgtagtgaggatcgtctctggaagatggtgggcctc
ccaaagggcaatgtaattcttacgggatctggccacagtgactggctgtccgactgctgt
ttccatccgagtggcagcaaattggctacctcaagtggtgacagcacaattaaactgtgg
gatctctcaaaaggtgaatgcatcttgaccttcgcaggacacaaccatgccatatggtcc
tgcacatggcactcttgtggtgatttcgtggcttctgcctcactggatatgacaagtaaa
atctgggatgttaatagtgagcggtgcagatatactttgtatggacacacggactctgtg
aacagcattgagtttttccctttctccaacactcttctcacggcttctgcagacaagacc
ttgtctgtgtgggatgcacgaacaggtaaatgtgagcagtctctgtatggccacatgcac
tccgtcaatgatgccaccttcacacctaggggtcacatactagcatcctgtgattcccgt
ggagttataaagctatgggacttccggaagctcattccaatcgtgtccattgatgtgggt
ccaagtcctggcaacgaggtgaattttgacccatcaggtcgagttttagctcaggcgagt
gccaacgggattatccatttgctggatcttaaatctgggcaaattcacaaactggtgggc
catgagagtgaagtgcacactgtgatattttcccaccgtgcagagaatctgtactctggt
ggttctgacggcaccattcggttgtggctctga

DBGET integrated database retrieval system