KEGG   Rattus norvegicus (rat): 501162Help
Entry
501162            CDS       T01003                                 

Gene name
Mreg, RGD1562333
Definition
(RefSeq) melanoregulin
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: MREG
Motif
Other DBs
NCBI-GeneID: 501162
NCBI-ProteinID: NP_001178931
RGD: 1562333
Ensembl: ENSRNOG00000015774
UniProt: D4A9U9
Position
9q33
AA seq 214 aa AA seqDB search
MGLRRWLRSACCCCPCRCLEEPARPEKEPLVSGNNPYSSFGATLERDDEKNLWSMPHDVS
HTEADDDRILYNLIVVRNQQTKDSEEWQRLNYDIYTLRQIRREVRNRWRRILEDLGFQRE
ADSLLSVTKLSTMSDSKNTRKAREMLLKLAEETSIFPASWELSERYLLIVDRLIALDAAD
DFFKIASQMYPKKPGVPCLVDGQRKLPYLPFPSP
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggggctgcgccgctggctgcggagcgcctgctgctgctgcccgtgccggtgcctggag
gagcccgcgcggcccgagaaggagccgctggtcagtggtaacaatccatattcctccttt
ggagcgactctggagagggatgatgaaaagaatttatggagcatgccccacgacgtgtct
cacacagaggcagatgatgacaggatcttgtataatctgatagtcgtccgtaatcagcag
accaaagactcagaggagtggcaaagactcaactatgatatctacaccctgcggcagatc
cgcagggaagtgaggaacaggtggagacgaatcttagaagatttgggctttcaaagggaa
gctgactctttgttgtcagtgaccaaactcagcaccatgagtgattccaaaaacacgagg
aaagcccgagagatgctgttaaaactggcagaagagacctctatcttcccagccagctgg
gagctctccgagagatatctcttgattgtggaccggctcattgctctagatgctgctgat
gacttctttaagattgctagccaaatgtaccccaagaaacctggggtcccatgcctggta
gacggccagaggaagctgccctaccttccatttccaagtccctga

DBGET integrated database retrieval system