KEGG   Rattus norvegicus (rat): 501181
Entry
501181            CDS       T01003                                 

Gene name
Efhd1, RGD1559565
Definition
(RefSeq) EF-hand domain family, member D1
  KO
K23921  EF-hand domain-containing family member D1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    501181 (Efhd1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   501181 (Efhd1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg
Other DBs
NCBI-GeneID: 501181
NCBI-ProteinID: NP_001102780
RGD: 1559565
Ensembl: ENSRNOG00000015596
Vega: OTTRNOG00000000975
UniProt: D4A9T5
Position
9q35
AA seq 240 aa
MSSEELACKLQRRLRLETRAETHQDSPQAAPCTAPAGHREPEPPAPAPTVSADSELNLKL
SSRLNIHQGAVRSRRSKVFNPYTEFPEFSRRLLKDLERMFKTYDAGKDGFIDLMELKLMM
EKLGAPQTHLGLKNMIQEVDEDFDGKLSFREFLLIFHKAAAGELQEDSGLLALAKFSEIN
VALEGVRGAKNFFEAKAQALACSSKFEAELKAEQDERKREEEARRLRQAAFRELKAAFSA
NT seq 723 nt   +upstreamnt  +downstreamnt
atgtccagcgaggagctggcctgcaagctgcagcgccggttgagacttgagacgcgggca
gaaacccaccaggacagcccccaggctgcaccgtgcactgccccagccgggcaccgggag
cctgaaccgcctgccccggcgcccacggtcagcgcggactccgagctgaacctcaagctg
agcagcaggctgaacatccaccagggcgcagtgcggtcccgccgctccaaggtcttcaac
ccctacacagagttcccggagttcagtcgccgcctcctgaaggatctggagaggatgttc
aaaacgtatgatgctggaaaagatggcttcatcgacctgatggagctgaaactcatgatg
gagaaactgggggcccctcagacccacctgggcctgaagaatatgatccaggaggtggat
gaagacttcgacggcaagctcagctttcgggagtttctgctcattttccacaaggctgct
gctggagagctgcaggaggacagtgggctgctggcactggccaagttttctgagatcaat
gtcgccctggagggtgtcagaggtgccaagaacttcttcgaagccaaggcccaggccttg
gcctgctccagtaagttcgaagctgagttaaaagctgagcaagatgagcggaaacgggaa
gaggaggccaggaggctccgccaggcagccttccgggagctcaaggcagctttcagcgca
tag

DBGET integrated database retrieval system