KEGG   Rattus norvegicus (rat): 501195
Entry
501195            CDS       T01003                                 

Gene name
RGD1562136
Definition
(RefSeq) similar to D1Ertd622e protein
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: UNC119_bdg
Other DBs
NCBI-GeneID: 501195
NCBI-ProteinID: NP_001102556
RGD: 1562136
Ensembl: ENSRNOG00000032398
Vega: OTTRNOG00000001025
UniProt: D3ZPS9
Position
9q37
AA seq 207 aa
MEMDVNGEPRSTLTTLPLPAAEGSSPGKAEAEKPRCSSTPCSPMRRTVSGYQILHMDSNY
LVGFTTGEELLKLAQKCTGGEDSKGEAMPPLRSRQLDAGLARSSRLYKTRSRYYQPYEIP
AVNGRRRRRMPSSGDKCTKSLPYEPYKALHGPLPLCLLKGKRAHSKSLDYLNLDKMSIKE
PADTEVLQYQLQHLTLRGDRVFARNNT
NT seq 624 nt   +upstreamnt  +downstreamnt
atggaaatggatgtaaatggggagcccagaagcaccctgaccaccctgcccctgcccgcg
gctgaggggagctctccaggaaaggcggaggcagagaaaccgcgctgctccagcacgccg
tgctcccccatgcgtcggactgtgtctggttatcagatcctccacatggactctaactac
ttggttggcttcaccaccggggaggagctcctgaagttagcccagaagtgcacgggaggg
gaagacagcaagggggaagccatgcctcccttgcgctctagacagctggatgcgggactg
gcgcgttcctcccgtctgtataaaactagaagtagatactatcagccatatgagatccca
gctgtcaatggcagaaggcgaaggcggatgcccagctcaggagacaagtgcaccaaatcc
ctaccttacgaaccctacaaggccctccatgggcccctgcctctatgtcttcttaaaggt
aagagggctcactccaaatccctggactacctcaatctagataaaatgagcatcaaggag
ccagctgacacggaagtgctacagtaccagcttcagcacctgaccctgcgaggggaccga
gtgttcgctagaaacaatacatga

DBGET integrated database retrieval system