KEGG   Rattus norvegicus (rat): 501203
Entry
501203            CDS       T01003                                 

Gene name
Myl12a, RGD1309537, Rlc-a
Definition
(RefSeq) myosin light chain 12A
  KO
K12757  myosin regulatory light chain 12
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
rno04510  Focal adhesion
rno04530  Tight junction
rno04611  Platelet activation
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    501203 (Myl12a)
   04530 Tight junction
    501203 (Myl12a)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    501203 (Myl12a)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    501203 (Myl12a)
   04670 Leukocyte transendothelial migration
    501203 (Myl12a)
  09158 Development and regeneration
   04360 Axon guidance
    501203 (Myl12a)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    501203 (Myl12a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    501203 (Myl12a)
   04147 Exosome [BR:rno04147]
    501203 (Myl12a)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     501203 (Myl12a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   501203 (Myl12a)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_5 UPF0154 EF-hand_9 Syntaxin SPARC_Ca_bdg DUF3741
Other DBs
NCBI-GeneID: 501203
NCBI-ProteinID: NP_001128489
RGD: 1309537
Ensembl: ENSRNOG00000015278
UniProt: P13832
Position
9q38
AA seq 172 aa
MSSKRAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
MGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEAIGTIQE
DYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtcgagcaaaagagcgaagaccaagaccaccaagaagcgccctcagcgcgcaacgtcc
aacgtgttcgccatgtttgaccagtcccagatccaggagttcaaagaggccttcaacatg
atcgaccagaaccgggacggcttcatcgacaaggaggacctgcacgatatgctggcttca
atgggaaaaaatccaactgatgaatacctggacgccatgatgaatgaggccccgggcccc
atcaatttcaccatgttcctcaccatgtttggagaaaagctgaacggcaccgaccctgag
gacgtcatcagaaatgccttcgcttgcttcgatgaggaagcaatcggcaccatccaggag
gattacctgagggagctgctcaccaccatgggcgaccgcttcacagatgaggaagtggat
gagctgtacagggaggcccccatcgacaaaaaggggaatttcaactacatcgagttcacg
cgcatcctcaagcacggagcgaaagacaaagatgactga

DBGET integrated database retrieval system