KEGG   Rattus norvegicus (rat): 501552
Entry
501552            CDS       T01003                                 

Gene name
Fancb, RGD1561555
Definition
(RefSeq) Fanconi anemia, complementation group B
  KO
K10889  fanconi anemia group B protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    501552 (Fancb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    501552 (Fancb)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex
     501552 (Fancb)
SSDB
Motif
Pfam: T3SS_basalb_I
Other DBs
NCBI-GeneID: 501552
NCBI-ProteinID: NP_001178932
RGD: 1561555
Ensembl: ENSRNOG00000003346
UniProt: D4A5I2
Position
Xq14
AA seq 853 aa
MPFNEQAKFLCYNGEVLVFQLSGGEFADLEKPTDPSVLGVKRMIFDRETSTFLLISTVFL
NINEKDSHLKILCCNCVSDFRTRINLPCILIQCRKYNSKAFKYYILFLHSPNQLEKLLSF
ELNHALDERAKIFDGPIVFWQYLNQFFYISSEIGKVTNISVSLSSIEWIGEIENFGLGFL
GLADPSGDKYKCTRKLSESDYEFSNSSFCAYALKSQEMLSNSYLIPLAYSTVVTRVHVCA
AEMVNKQLKMSLIALTRKNQLILFQNGIPVRTCQLPFLDPRSVQILDAGKRNRFFIVSFL
SKACAVSEKKFKVVAKWEQLSLVLVNDFAGVGTEQVLVVFEDSLDADQLTSFTVTDFVKI
WYSTKPLDCCEDPLAEEEHENYYLVLPALEAQLDNSFIFLNQFQQHISFKDKFIANSWKA
LLNSVYGNVDSMPSDEEVQLEQGGLVPFCDEDENSVPTPEENLPDNFPEPEHVIEQTWCH
VLDDDLVVGVKVTSLKPSDGMTLSLIMDQANRSSFHLMKCQSQLISLSMNSFPETYLLSK
ETGPEIKRMKLTSGSQEEESSFCGQSAKAESTYVITAITSLSPLLVFNKLSCTVLLNVSD
RDNPKNTVHDYVFCGHLDFNLQDLFSKNHLLAFPKKQSIEQTENLFSLLTALPKYAFCVT
SPTHAPNLMKVWLLKHMKCAKIQECTEIYLYKKLRNCEALFSWEQRTAFEGILTIYCRSL
GVLFQCLDHLIKVIPEICSFKYLRFENEDFLVDHLSSTLEAELVTFCSVSTSAFEYVRGG
CMYNCSTSKTDNRATTFSGRRAKIRHYKRQVQREKILKHLNRTVNVSSYAEMTLALAEIQ
LRSDLIVKTLTDL
NT seq 2562 nt   +upstreamnt  +downstreamnt
atgccatttaatgagcaagcaaagttcttgtgctataatggggaagtccttgtttttcag
ttgtctggaggagagtttgcagatttagaaaagcctacagatccatctgtcttaggtgtc
aaaaggatgatatttgacagagaaactagtacattccttctgatatccacagttttttta
aacatcaatgagaaagattctcatttaaaaattctgtgttgtaactgtgtgtcagatttc
agaactagaattaaccttccttgcattttgatacaatgtagaaaatacaatagcaaagct
ttcaaatattatatactgtttcttcacagtcccaaccagttggaaaaacttttgagtttt
gaactaaaccatgcattggacgagagggcaaagatctttgatggccctatagttttttgg
caatatctcaatcaattcttctatatctcttccgaaattgggaaagttactaatatatca
gttagcctttcctcaatcgagtggataggtgagattgaaaattttggcttaggtttcttg
gggctagcagatccatctggggataaatataaatgtacccgcaagctttcagaatcagat
tatgaattttccaattccagcttttgtgcatatgctcttaaaagtcaagaaatgttaagc
aatagttacctgatccctctggcttacagtactgtggtaactcgtgtgcatgtctgtgca
gccgagatggtgaacaagcagttaaaaatgtctctgattgccctgacgcgaaagaatcag
cttattttgttccagaatggcattcccgtaagaacttgtcagcttccatttctagatccc
cgttcagttcaaattctagatgcagggaaaagaaaccgatttttcatcgtgtcattcctg
tccaaggcttgcgctgtttcagaaaagaaatttaaggttgtggctaagtgggaacaactt
agcttggtactggttaatgactttgctggagttggaactgagcaagtcctggtcgttttt
gaggactctctggatgcagatcagctgacctcatttacagtaacagattttgtcaaaata
tggtattcaaccaaaccactggattgctgtgaagaccctctggctgaagaggaacatgaa
aattattatttggtgcttccagcactggaagcccaattagacaattcttttatttttctt
aaccaattccagcagcatatctcatttaaggataaatttattgcaaactcttggaaggct
cttttaaactcagtttatgggaacgttgatagtatgccaagtgacgaggaggtacagtta
gaacagggtggtcttgttcccttctgtgatgaagatgaaaacagtgtccctacccctgag
gaaaacttaccagacaattttccagagccagaacatgttatagagcagacatggtgccat
gtgctagatgatgacttagttgttggcgtgaaagtcacatctttgaagccgtctgatggg
atgactttatcactgataatggatcaagccaacaggtccagttttcatcttatgaagtgt
caaagtcagttgattagtttgagtatgaattcttttccagaaacatacttgttgtcaaag
gaaacaggaccagagatcaaaaggatgaagctgacctctggtagccaggaagaggaaagc
tctttttgcggacagtcagctaaggcagaatctacatacgtaatcactgctataacgtct
ctttctccactgttagtattcaacaaattgtcttgcactgtgctgctaaacgttagtgac
agagataaccctaaaaatactgtgcatgattatgttttctgtggccaccttgattttaat
ctgcaagatctttttagtaagaaccacctactggcattcccgaagaagcaatcaatagaa
cagacggagaatcttttttcacttctcacagcattgcccaagtatgccttctgtgtcacg
tcacctacccatgcccccaatttaatgaaggtatggctcttaaaacacatgaaatgtgca
aaaatccaagaatgcacagaaatatacctttataaaaagctacgaaattgtgaagcactc
ttctcctgggagcagagaacagcatttgaaggaattttaacaatatattgcaggagccta
ggagttttgttccagtgtctcgaccatctcatcaaagttattcctgaaatatgttccttc
aaatatctgaggtttgaaaatgaggatttcttagttgatcatttgtcatccactttggag
gcagaactggttaccttttgctctgtttctacttctgccttcgagtatgttagaggtgga
tgtatgtataactgtagcacaagcaaaacagataatagggccacgactttttcagggaga
agggccaaaatccgtcactacaagcgccaagttcagagagaaaaaatattgaagcacctg
aataggacagtaaatgtcagcagctatgccgagatgactttggcattagctgagatacag
ttgcgatcagacctcattgtaaagacactgactgatttgtaa

DBGET integrated database retrieval system