KEGG   Rattus norvegicus (rat): 501555
Entry
501555            CDS       T01003                                 

Gene name
Rai2, RGD1560139
Definition
(RefSeq) retinoic acid induced 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: SOBP
Other DBs
NCBI-GeneID: 501555
NCBI-ProteinID: NP_001102786
RGD: 1560139
Ensembl: ENSRNOG00000006670
UniProt: D3ZGZ4
Position
Xq14
AA seq 529 aa
MDDLQSQNLSMDMTDSPPTLANNRLENGMAQLITTEAWNINSTDLVKKALVTVPAPSILN
PPAESQSGMALKVAATVLQPLCLGESPVVMPIHMQVEGSSAPELNPNGNATYVMTTQGPV
QLPVVLEQHVFQHLNSPLVLPQEAPCSSNAIHNNLFQGAEDSEAQPQLLDLRIPSQPQEP
TLPFEAVLQNLFPTQGSLGPPPCQPPPGYAPVPPQPFSSPLSPLVPPATLLVPYPVIVPL
PVPVPIPIPVPVPQSSESKFSPSFPKPPSSFGLHSFKGTQTTLEKDELKPLDILQPKEYF
QLSRHTVIKMGGENEALDLSMKSVPWLKAGEASPPVFQEDAALDLSLAAHRKAEVPPETL
YNTSGSADIQGHTLLEKRPSGMEMPFAPAKSREASAMMDSHSSSSNGTEMVSQPIHPGSE
LKPENNIEIVSESQAAKVIVSVEDAVPAIFCGKIKGLSGVSTKNFSFKREDSVLQGYDIN
SQEDESLGNTEPLRKPIKNRSIKLKKVNSQEIHMLPIKKQRLATFFPRK
NT seq 1590 nt   +upstreamnt  +downstreamnt
atggatgacctgcagtcccagaacctttcaatggacatgactgattcccctcccactttg
gctaataacagactggagaacggcatggcccagctgataactaccgaggcctggaacatc
aactccactgacctggtaaagaaggccctggtgaccgtgcctgccccatcaattctgaac
cccccagctgagtcacagagtggcatggctctgaaggtagcagccaccgtgctgcagccc
ctgtgccttggggaaagcccagtggtgatgcccattcacatgcaggtggagggaagctct
gcgccagaactcaaccccaacggcaatgctacctacgttatgacgacacaaggccccgtg
cagttaccggtggtgttggaacagcatgttttccagcatctcaactcccctctagtcctg
cctcaggaggccccgtgctcctccaatgctatccacaacaatctcttccagggggctgag
gactctgaggcccaacctcagctcctggacctgaggattccaagtcaaccacaggagcct
acgttgccttttgaagctgtgctccagaatttattccccacccaaggctctttgggccct
ccaccctgccagcctcctcctggctatgctccagtgcctccccagccctttagctccccc
ttgtctcccctagtcccaccagctaccctcttggtgccctatcccgtgattgtccccttg
ccagttccagtgcccattcccatccctgtcccagtgcctcagagttctgaatctaagttc
agccccagtttccccaagccaccatcttccttcggcctgcactcctttaaaggtactcag
accactctggaaaaggatgaactgaagcccttagacatcctccagccaaaggagtatttc
cagctcagccgccacacagttatcaagatggggggtgagaatgaggccctggatctgtcc
atgaagtcagtgccctggctcaaggctggggaagcaagccccccagtctttcaagaggac
gcggccctggatctgtctttggcagcccaccgaaaagctgaggttcctccagagacattg
tataacaccagtgggtcagcagatattcagggtcacaccctgctggagaaacgtcccagt
ggcatggaaatgccctttgccccggccaagtctcgtgaggcctcagccatgatggatagt
cacagcagcagcagcaatggcaccgagatggtcagccagcccatccaccctggcagtgag
ttaaagcctgaaaataacattgagatcgtaagtgagtctcaggcagccaaggtcattgtg
tcagttgaagacgctgtgcctgccatcttctgtggcaagattaaaggcctctcaggggta
tccaccaaaaacttctccttcaaaagagaagactctgtgcttcagggttatgacatcaac
agccaagaagacgagtccctgggaaacaccgagcctcttaggaaacccatcaaaaatcgg
agcataaagttaaagaaagtgaactcccaggaaatacacatgctcccaattaaaaaacaa
cggctggccacctttttcccaagaaagtaa

DBGET integrated database retrieval system