KEGG   Rattus norvegicus (rat): 501563
Entry
501563            CDS       T01003                                 

Gene name
Prkx
Definition
(RefSeq) protein kinase, X-linked
  KO
K19584  protein kinase X [EC:2.7.11.11]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    501563 (Prkx)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     501563 (Prkx)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  PKA family
   501563 (Prkx)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo
Other DBs
NCBI-GeneID: 501563
NCBI-ProteinID: NP_001029135
RGD: 1564076
Ensembl: ENSRNOG00000060168
UniProt: Q5BK52
Position
Xq21
AA seq 358 aa
MEPPACAEAAVKDPAARDHDPVDAKISAPAADPLPRTSSQKEGHSLQDWDTIATVGTGTF
GRVNLVKEKTGRRYCALKIMSIPDVIRLKQEQHVQNEKAVLKEINHPFLIKLLWTDHDNR
FLYMLMEFVPGGELFTYLRNRGRFSSVAAIFYATEIVCAIEYLHSKEIVYRDLKPENILL
DREGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSG
FPPFFDDNPFGIYQKILACKIDFPRQLDFTSKDLIKKLLVVDRTRRLGNMKNGAEDIKRH
RWFRGVEWESVPQRKLKPPIVPKLSSDGDISNFETYPEGELDKTPSVSDEDLETFKNF
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggagccacccgcttgtgccgaggcggccgtaaaagatcctgcagccagagaccatgac
cccgtggacgcaaagatctcagcgcccgccgcggatcccctacccaggacgtcgtcacag
aaagaggggcactcgttacaagattgggacaccatagccaccgtgggcactggaaccttt
ggccgagtaaacctggtgaaggagaagacaggcaggcgatactgtgccttgaagattatg
agcatcccagatgtcatccgcctgaagcaggaacaacatgtgcagaatgagaaagcagtc
ctgaaggaaataaaccaccccttcctcattaaactgctttggacagaccatgacaaccgc
ttcctgtacatgctgatggagtttgtgcctggtggtgagctgttcacctacctgcgtaat
cgtggccgcttttcctcagttgctgcaatcttctatgccacagagattgtgtgtgccata
gaatacctgcactccaaggaaatcgtatacagggacctgaagcctgaaaacatccttctg
gacagggaaggacatatcaaactcactgacttcggcttcgccaagaaactggtggatagg
acatggactctctgtgggacaccggaataccttgccccagaagttatccagagcaaaggt
catggaagagctgtggactggtgggcattgggcatccttatattcgagatgctgtctggg
tttcccccatttttcgatgacaacccatttgggatttaccagaaaatccttgcatgcaaa
atagatttccccagacaattggatttcacctctaaggacctcatcaagaagcttctggtg
gtagacaggacccggcgcctgggcaacatgaagaatggggcagaagacatcaagcggcac
cggtggttccgaggtgtggagtgggagtccgtgccacagaggaaacttaagccacccatt
gtgcccaagttatccagtgatggtgacatctccaactttgagacttatccagagggtgag
ttggacaagactccttctgtatctgatgaagatctggaaacattcaaaaatttctga

DBGET integrated database retrieval system