KEGG   Rattus norvegicus (rat): 501584
Entry
501584            CDS       T01003                                 

Gene name
Amer1, Fam123b, RGD1560322
Definition
(RefSeq) APC membrane recruitment protein 1
  KO
K19407  APC membrane recruitment protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    501584 (Amer1)
SSDB
Motif
Pfam: WTX
Other DBs
NCBI-GeneID: 501584
NCBI-ProteinID: NP_001102790
RGD: 1560322
Ensembl: ENSRNOG00000007984
Vega: OTTRNOG00000000520
UniProt: D3ZCP6
Position
Xq22
AA seq 1111 aa
MEIQQDETVQIKRTSTSSDAQDQGAEKGAKNKTAETTEGSTSEPPLSGPGRLKKTALKLF
GGKKGICTLPSFFGGGRSKGSGKGSSKKGLNKSKTHDGLSESSHGPEDVVVEETELSTPL
SKSPSQFPSSQSAHGALEIGSRHKTSVTEAVEKAGVEKVPSVHKPKKGLKGFLNSIRRHR
KSKVSGADQSGLGAKELEGTRTMSQEHVSSISLPSSEEIFRDAIKENTKPQDAPGPKMSP
AREHFSLTTEKTACKNPEKLTMTCASEFMQPKPILEASSLEEPHTSETEGKVVTGDANPP
NGPVGDQLSLLFGDVTSLKSFDSLTGCGDIIAEQDMDSMTDSMASGGQRANRDGTKRSSC
LVTYQGGGEEMALPDDDDNEEEEEEDEEVELEDEEEEVKDGEEDDDLEYLWASAQIYPRF
NMNLGYHTAISPSHQGYMLLDPVQSYPNLGLGELLTPQSDQQESAPNSDEGYYDSTTPGF
EDDSGEALGLVHRDCLPRDSYSGDALYEFYEPDDSLEHSPPGDDCLYDLRGRNSEMLDPF
LNLEPFSSRPPGAMETEEERLVTIQKQLLYWELRREQREAQEACAREAHAREAYSRDTHT
RESYGKNTRARETQALEVHSQEGRVQETKVRQEKPALEYQMRPLGPSVMGLVPGTPGGSQ
TSHRGTTSAFPATSSSEPDWRDFRPLEKRFEGTCSKKDQSTCLMQLFQSDAMFEPDMQEA
NFGGSPRKAYPSYSPPEEPEEEEDENEGNATVSFSQALVEFTSNGNLFTSMSYSSDSDSS
FTQNLPELPPMVTFDIADVERDGEGKCEENPEFNNDEDLTASLEAFELGYYHKHAFNSYH
SRFYQGLPWGVSSLPRYLGLPGVHPRPPPAAMALNRRSRSLDNAETLELELSSSHLAQGY
VESDELQDHQEDSDEEGEEEEGEWGRDSPLSLYTEPPGVYDWPPWAHCPVPVGPGLAWLS
PNQLDEPFNQSSYVQATCCVPPVAMSVPGRAPGDSVSQPARPSHLPLPMGPCYNLQSQAS
QSGRARPRDVLLPVDEPSCSSISGANSLSQAKPVGITHGIPQLPRVRPEPLQLQPNHYRA
SNLDLSKERGEQGASLSTSYSSTAMNGNLAK
NT seq 3336 nt   +upstreamnt  +downstreamnt
atggagattcaacaggatgaaacagttcaaatcaagaggacatcaacttccagtgatgcc
caagatcagggagctgagaagggagccaagaataagacagctgagacaacagaaggatca
acatcagagccacccttatcaggcccaggtaggctgaagaaaactgccttgaaactcttt
ggtggcaagaagggaatctgtactctgcctagtttctttgggggtggacgaagcaaaggt
tctgggaaaggcagctccaagaagggtctaaacaagagcaagacccacgatggtctgagt
gaatcatctcacggccctgaagatgttgtcgttgaagaaacagagctctctacacctttg
tccaagtcaccttctcaatttcctagctcccagagtgcccatggagctttggagataggc
tctagacataagacatctgtgactgaagctgtagagaaagctggagttgagaaggtaccc
tctgtgcacaagccgaagaaaggcctaaaaggctttttaaacagtatccgccgtcaccga
aagagcaaggtttctggggctgaccaaagtgggctaggggccaaggaacttgaggggaca
agaaccatgtctcaagagcatgtgagttcaatctctctgcccagctctgaggagatattc
cgagatgctataaaggaaaataccaaaccccaggatgcccctggaccaaaaatgtctcca
gcaagagaacatttttcactaactactgagaagacagcttgtaaaaatccagaaaaactt
acaatgacctgtgcctcagagttcatgcagcccaagcctattcttgaagctagtagtcta
gaagagccccacacttcagaaacagaaggaaaagtggtaacaggagacgcaaacccaccc
aatggcccggttggggatcagctaagcctcttgtttggggatgttacatccctgaaaagc
tttgactcgctgacaggttgtggtgacattatagcagaacaggacatggacagtatgaca
gatagcatggcctctggtggccagagggccaaccgagatgggaccaagcgaagttcctgc
ttggtgacctaccaaggaggtggggaggaaatggccttgccagatgacgatgacaatgaa
gaggaagaagaagaggatgaggaggtagaattagaggatgaggaagaggaggtcaaggat
ggggaggaagatgatgacttagagtatctgtgggcaagtgcccagatatacccaagattt
aatatgaacctgggctatcatactgctatatctcccagccaccagggctacatgcttctt
gacccagttcagtcttatcctaacctaggcctgggagaacttttgacacctcagagtgac
cagcaagagtctgctcccaatagtgatgaaggttattatgactctaccacaccaggattt
gaggatgattcgggtgaggccctggggcttgtccatagggattgtctacccagagacagc
tatagtggtgatgctctttatgaattctatgagccagatgacagtcttgagcactcccca
cctggggatgactgcctttatgacctccgtggacgcaactcagagatgttggatcctttc
ttgaacttggagcccttttcttctcgaccacctggggcaatggaaacagaagaagaacgg
ctggtaaccatccagaagcagttgctgtactgggaacttcgccgggagcagcgtgaggct
caagaggcatgtgccagagaggctcatgccagagaagcttattctcgagacacccacact
cgggaatcttacggcaaaaatacccgagcccgagaaacccaagccctagaggttcattct
caagagggtcgagtccaagagaccaaagtacggcaagagaagcctgccttggaatatcag
atgaggccattaggcccctcggtgatgggtctggtgccagggacaccaggaggttctcag
acttcacaccggggaaccacttcagctttcccagctacttccagtagtgaaccagactgg
cgggatttccgtcctctggagaagcgttttgaggggacttgctccaaaaaagatcaaagt
acttgtttaatgcagctctttcagagtgatgccatgtttgaaccagacatgcaagaagca
aatttcggaggctctcccaggaaggcctaccctagttactcaccccctgaagagccagag
gaagaggaagatgagaacgaagggaatgccactgtgagtttttcacaagctctagtagag
tttaccagcaatggaaacctttttaccagcatgtcctacagctctgattctgactcatcc
ttcactcaaaatctccctgagttgccccccatggtcacctttgacattgctgatgtggaa
cgggatggagaaggcaagtgtgaagagaatcctgagttcaacaatgatgaagatcttacg
gcctccttggaagcttttgagctgggttattaccacaaacatgccttcaacagctatcac
agccggttctaccaaggcctgccctggggtgttagcagcctccctcgatacttaggactc
ccgggtgtacatcctcgacctccacccgctgcaatggcactcaataggagaagccgttcc
cttgacaatgcagagaccctggagctggagctctccagttctcacctagcccagggttat
gtggagtctgatgagctacaggaccaccaggaagattcagatgaagaaggtgaagaagag
gaaggagaatggggccgggacagccccttgtcactctacactgaacctccaggggtctat
gactggccaccctgggctcactgtcctgttccagtgggaccaggtcttgcttggctaagc
cctaatcagttggatgagcctttcaatcagtcttcatatgtgcaagcaacctgttgtgta
cctcctgtggcaatgtcagtgccaggaagagcacctggagactctgtgtctcagccagct
cgaccttcacacctacccctgcccatgggtccttgctataaccttcaatcacaggcctcc
cagagtgggagggccaggcctcgggatgtactgctgcctgtagatgagcccagttgctcc
tccatttctggagccaactctctgtctcaagccaagcctgtaggcatcacccatggtatc
cctcagctgcccagggtacggcctgaaccccttcagcttcaacccaatcactaccgagct
tccaaccttgacctttcaaaggagaggggtgaacaaggtgcctctctctctaccagctac
tcctccactgccatgaatggaaacctagccaagtag

DBGET integrated database retrieval system