KEGG   Rattus norvegicus (rat): 501647Help
Entry
501647            CDS       T01003                                 

Gene name
Fam122b, RGD1560129
Definition
(RefSeq) family with sequence similarity 122B
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 501647
NCBI-ProteinID: NP_001160058
RGD: 1560129
Ensembl: ENSRNOG00000002285
UniProt: D3ZN42
Position
Xq37
AA seq 254 aa AA seqDB search
MAQEKMELDFEADTSEGGTLRRSNSAPLIHVLSDLSQVFEPYPLRTGRNSATVMSHHSLE
EGLDLMNRETANEREPQGGMQISHSWDESLSLSDSDFDKPEKLYSPKRIDFTPVSPAPSP
TRGFGKCTSPSLQMFVGSSEVPPSSVPNPRHFSRRSQSPVKCIRPSVLGPLKRKGEMEIE
SQPKRPFQGATNMLSTDATQLSDFSSCSDILDGSSVSSGLSSDSLATGSAPAESPVACSN
PCSSFILMDDLSPK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggagaaaatggagctggattttgaggctgacacatctgaggggggcaccctg
agacggtccaacagtgctcccctgatccatgtgctcagtgacctttcccaggtttttgag
ccatatccacttagaactgggaggaacagtgcgacagttatgagccatcatagcttggaa
gaaggcctggatttgatgaacagagaaactgcaaatgaaagagaaccacaaggaggaatg
cagataagccactcatgggacgaaagcttaagcctgagcgatagtgattttgacaagcca
gagaaattatattctccaaagagaattgacttcactccagtttctccagcgccttcccca
accagaggatttggaaagtgcacatcgccatccttgcaaatgtttgtgggcagcagtgag
gtgccaccaagttctgttcctaatccaagacatttttcaaggaggagtcagagcccagtc
aagtgcattaggcccagcgttcttggtcctcttaagagaaaaggggaaatggagatagaa
agccagcctaagagaccgttccaaggagcaaccaacatgctgtctacagatgctacacaa
ttgtctgatttcagttcatgttcagatattttggatggcagtagtgtcagcagtggcttg
tcctcagactcactggctacaggcagcgctcccgcagagtctccagtagcatgctccaat
ccatgctcttcgttcatcttgatggatgatctctcacccaagtga

DBGET integrated database retrieval system