KEGG   Rattus norvegicus (rat): 501706
Entry
501706            CDS       T01003                                 

Gene name
Mis12
Definition
(RefSeq) MIS12 kinetochore complex component
  KO
K11543  kinetochore-associated protein MIS12
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    501706 (Mis12)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    KMN network proteins
     MIS12 complex
      501706 (Mis12)
SSDB
Motif
Pfam: Mis12 Glyco_hydro_cc 60KD_IMP
Other DBs
NCBI-GeneID: 501706
NCBI-ProteinID: NP_001041437
RGD: 1564837
Ensembl: ENSRNOG00000007725
UniProt: Q7TQ72
Position
10q24
AA seq 206 aa
MSVDPMAYEAQFFGFTPQTCLLRIYIAFQDHLFEVMQAVEQVILKKLEGIPDCEISSIQT
RKCTEKFLCFMKGRFDNLFGKMEQLILQSILQIPPNILLPEDKCQETNPFSEEKFQLLKQ
EIKELQEKYKVELCTEQALLAELEEQKTVKAKLRETLTFFDELENIGRYQGTSNFRESLV
SLVQNCRKLQDIRDNVEKEGKRLETQ
NT seq 621 nt   +upstreamnt  +downstreamnt
atgtctgtggatccgatggcctatgaggcccagttctttggcttcaccccacagacttgc
ttgctgaggatctacatagcatttcaagaccacctctttgaagtgatgcaggctgttgaa
caggttatcttaaagaagctggagggcattccagactgtgagattagctctatccagact
cgtaaatgcacagagaagtttctttgcttcatgaaaggacgttttgataacctttttggt
aaaatggagcagctgattttacaatcgattttgcaaattcctccaaacatcctgcttcct
gaagataagtgtcaggagacgaatcctttcagtgaagaaaaattccagcttctcaaacag
gaaatcaaagagttacaggagaaatataaggttgaattatgcactgagcaggcccttctt
gcagaattagaggagcaaaaaactgttaaagccaaactcagagagacgttgactttcttt
gatgagcttgaaaacatcggcaggtatcaaggaactagtaactttagggagagtttggtg
tctctggtccagaactgcagaaaactccaggatattagagataatgtagaaaaagagggc
aaaaggctggaaacacaataa

DBGET integrated database retrieval system