KEGG   Rattus norvegicus (rat): 501890Help
Entry
501890            CDS       T01003                                 

Gene name
RGD1561699
Definition
(RefSeq) similar to DNA segment, Chr 5, ERATO Doi 577, expressed
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1981 Band_3_cyto LRR_6
Motif
Other DBs
NCBI-GeneID: 501890
NCBI-ProteinID: XP_006250776
RGD: 1561699
Ensembl: ENSRNOG00000047839
UniProt: D3ZRT5
Position
14p22
AA seq 481 aa AA seqDB search
MSVQSPPTLEKLAIQSLLRNEDVAMSSLGELPAVLFPALFKEAFTGKHINFVKEMVAAWP
FPCLPVGALMKTPNLEMLQAVLDGVDIQLTRKFHPRRTKLQVLDLRNMHHYFWNIQGGEE
DSSCSAENLKEKKVMKVFHRYALRKRVKVIVDMYICSCLKEEQTCLLKWAQQRKGSLHFC
CTKMKVWNLPVCVIREILKVFDPQHITELELHTEWTLLELAHFAPYFGQMRNLQKAFLAP
LHRIMFSNSNGIGDREAKCIKKFISQFSKFNCLQHLCMFCVHFLGDHMNQVLGCLMTPLE
TLSITYYLISQKDLDSLSRSQSLFQLKHLDLRGVVLCDLDIMPLRGLLEKVADTLETLDL
QWCKMTDSQLYALLPALRHCCQLTMVNFYSNNFSVPILKDLMQHIANWSRIRVQQYPAPL
ECYDDLAQVSVKRFAELSSELMYTLGVIRQTKNISFATDICHTCGQRCVYHNGSRLCCCW
H
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttcagagcccacccacactcgagaagctggcaattcagtctctgctaagaaat
gaagatgtggccatgtcctctctgggagagctgcctgctgtgctcttcccagcactgttc
aaggaggccttcactggaaaacacatcaacttcgtgaaggaaatggtggcagcttggcct
tttccctgtctccctgtgggtgcattgatgaagacacctaacctggaaatgttgcaggct
gtgctagatggagtagacatacaactgacaagaaagtttcaccccaggagaacaaaactg
caggttctcgacctgagaaatatgcaccattacttctggaacatacagggtggagaagaa
gatagcagctgttcagcagagaacttgaaagaaaagaaagtcatgaaagtctttcacaga
tatgcactaaggaagcgtgtgaaggtcatagttgatatgtacatctgttcctgcctgaag
gaagaacaaacttgcttgttgaagtgggcccagcaaagaaagggctccctacatttctgc
tgtacaaagatgaaggtctggaatctaccagtctgtgttatcagagagatcctgaaggtt
tttgatccacagcatatcacagaattagaactgcatactgagtggactctgttagagctg
gcacattttgctccctactttggacagatgagaaatctccagaaagccttcctggcaccc
ctgcacaggatcatgttctctaatagcaatggaataggagacagagaagccaagtgtatc
aagaagtttatatctcagttctccaaattcaattgtctccagcatctctgcatgttctgt
gtccattttcttggagatcacatgaatcaagtcctagggtgcctgatgactcccttggag
actctttcaatcacatactacctaatttcacagaaagacttggattccctatcccgcagt
caaagcctatttcagctaaaacatctggatttgagaggagtggtcttatgtgatctggat
atcatgcctctgagaggtctactagagaaagtggcagacactcttgagactctggatttg
cagtggtgtaagatgacggactcccagctttatgccctcctacctgccctcagacattgc
tgtcagctcaccatggtcaacttctacagcaataacttctctgtgcccattctgaaggat
ctgatgcagcacatagccaactggagcaggatccgtgtgcaacagtaccctgcccctctg
gagtgctatgatgacttggctcaagtttctgtaaaaagatttgccgaactttcttctgag
cttatgtatactctcggagtaataaggcagaccaagaacatctcctttgctacagatatc
tgccatacatgtggtcagcgctgtgtctatcacaatgggtccagactttgttgttgctgg
cactaa

DBGET integrated database retrieval system