KEGG   Rattus norvegicus (rat): 501996
Entry
501996            CDS       T01003                                 

Gene name
Il25
Definition
(RefSeq) interleukin-25
  KO
K05493  interleukin 17E
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    501996 (Il25)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    501996 (Il25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    501996 (Il25)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   501996 (Il25)
SSDB
Motif
Pfam: IL17 DUF6151
Other DBs
NCBI-GeneID: 501996
NCBI-ProteinID: NP_001178936
RGD: 1561632
Ensembl: ENSRNOG00000016804
Vega: OTTRNOG00000000840
UniProt: D3ZLB1
Position
15
AA seq 169 aa
MYQAVAFLAMVVGTHTVSLRIQEDCSHLPRCCPSKQQEFPEEWLKWNPAPVSPPEPLRHT
HHPESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPMG
NSVPLYHNQTVFYRRPCHGEQGAHGRYCLERRLYRVSLACVCVRPRMMA
NT seq 510 nt   +upstreamnt  +downstreamnt
atgtaccaggctgttgcgttcttggcaatggttgtgggaacccacaccgtcagtttgcgg
atccaggaggactgcagccacttacccagatgctgtcccagcaaacaacaagaattcccc
gaggagtggctgaagtggaaccctgcacctgtgtctcccccagagcctctgaggcacacc
caccacccagaatcctgcagggccagcaaggacggccctctcaacagcagggccatctct
ccttggagctatgagttggacagggacttgaatcgggtcccccaggatctgtaccatgct
cgatgcctgtgcccacactgcgtcagcctacagacaggatctcacatggacccaatgggc
aactcagtaccactctaccacaaccagacagtcttctaccggcggccatgccacggcgag
caaggtgcccacggccgttactgcttggagcgcaggctctaccgagtctccttggcttgt
gtgtgtgtgcggccccgtatgatggcttag

DBGET integrated database retrieval system