KEGG   Rattus norvegicus (rat): 502020Help
Entry
502020            CDS       T01003                                 

Gene name
Lrch1
Definition
(RefSeq) leucine rich repeats and calponin homology domain containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 CH LRR_1 CAMSAP_CH
Motif
Other DBs
NCBI-GeneID: 502020
NCBI-ProteinID: NP_001128199
RGD: 1595678
Ensembl: ENSRNOG00000009412
UniProt: B2GV98
Position
15q11
AA seq 677 aa AA seqDB search
MATPGSEPQAFAPALSVTALHPHIHQHHQHHGSTGSAGFNLPLNRGLERALEEAANSGGL
NLSARKLKEFPRTAAPGHDLSDTVQADLSKNRLVEVPMELCHFVSLEILNLYHNCIRVIP
EAIVNLQMLTHLNLSRNQLSALPACLCGLPLKVLIASNNKLGSLPEEIGQLKQLMELDVS
CNEITALPQQIGQLKSLRELNVRRNYLKVLPPELVDLPLVKFDFSCNKVLVIPVCFREMK
QLQVLLLENNPLQSPPAQICTKGKVHIFKYLSIQACQIKTADSLYLHSIERPHSHQHVED
SKKDSDSGVGSDNGDKRLSATEPSDEDTVSLNVPMSNIAEEDQTTKEDACHRLAPAEGDF
QPTPSLLGDSGSSGQEREQFAGRADVLHCELMNYIKDQAEDCEELLRIEEDAHWQTEELL
NSSKDQDLDIVMIEQLREAEDLLQGPNGLTTDITERSILNLYPMCSAEALEFPDSSLNGQ
LQLERSPEREVQNDVTLQSNGSQCSPNEIREDSPSGSPTANITAPFGLKPRSVFLRPQRN
LESIDPQFTIRRKMEQMREEKELVEQLRESIEMRLKVTLHEDLGAALMDGVVLCHLANHV
RPRSVASIHVPSPAVPKLSMAKCRRNVENFLEACRKLGVPEEKLCLPHHILEEKGLVKVG
MTVQALLDVTVTKALFT
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgccgggaagcgaaccccaagctttcgcgcccgccctctcggtaaccgccctg
cacccgcatatccaccagcaccaccagcaccacggaagcacgggcagcgcgggcttcaac
ctgcccttgaaccgtggtttggagcgcgcgctagaggaggcagccaattctgggggcttg
aacctgagcgccaggaagctgaaggaatttcccaggactgcagccccgggacatgacctc
tcggacacggttcaggcagatctatctaaaaacagactggtggaagtgccaatggagctg
tgccatttcgtatcactggaaattcttaacctgtatcacaactgtatcagagtcattccc
gaggccattgttaatttgcagatgttgacccacctgaacttgagtcgaaatcagctgtct
gccctgcccgcctgcctgtgtggtctgcctctcaaagtcttaatcgcaagcaacaacaag
cttggatccctgcctgaagagataggtcagctcaaacagttaatggagttggatgtcagc
tgcaatgagatcacagccttgccccagcagataggccagctgaagtctctccgggaactg
aatgtccgaagaaattaccttaaggttttaccaccagagctagtagatctccccttggta
aagtttgacttttcctgcaacaaagtgctggtgatccccgtctgctttcgggagatgaag
caactgcaagtgctcctccttgagaacaaccccctgcagtccccgccagctcagatttgc
acgaaaggaaaagtgcacatatttaagtacctgagcatacaggcatgccagataaagaca
gccgactccctctacctgcactccatagagaggccccattcacaccagcacgtggaagac
agtaagaaggactctgactcgggggttggaagtgataatggagataagcggttatctgcc
actgagccctctgatgaggacacggttagcctcaacgtgcccatgtcgaacatcgcagag
gaagaccagaccaccaaggaggatgcgtgccatcgactcgcccccgctgaaggagacttt
cagccgacaccttcccttttgggtgacagtggcagctcaggacaagaaagagagcagttt
gctggccgtgcagatgttctacactgcgaacttatgaactatattaaggaccaggcagaa
gactgtgaagagctattacggatagaagaggatgctcactggcagacggaagaactacta
aattcatccaaagaccaggatttggatatagtgatgatcgagcagctgagagaggcagaa
gatttgctgcagggtcccaacggtctaaccacggacattacagagagaagtattttgaat
ctgtaccccatgtgctcagcagaagccttagaattccctgattcttcactcaatggtcag
ttgcagctcgagaggtctccagagcgtgaggtgcaaaatgatgtaacgttacagagtaat
ggaagccagtgttctccaaatgagataagagaggactccccttcagggtctcccactgca
aacatcacagctccatttggcctgaagcctcgttcagtgtttctaagacctcagagaaac
ttggaatctatagacccgcagtttacgattcggaggaagatggagcagatgagagaggag
aaggagctggtggagcagctccgtgagagcatcgagatgaggttgaaggtgaccctgcat
gaagacctgggggcagcactcatggatggcgtagtgctctgccacctggccaaccacgtc
cgaccgagatctgtcgccagcatccacgtcccctcacctgccgttcccaaactcagcatg
gccaagtgccggaggaatgtggaaaacttcctggaagcgtgcagaaaacttggcgttccc
gaggaaaagctctgtctgcctcatcacatccttgaagagaaaggcctggtcaaagtgggc
atgactgttcaagcgctgttggacgtcaccgtcacaaaagctctgttcacatga

DBGET integrated database retrieval system