KEGG   Rattus norvegicus (rat): 502176
Entry
502176            CDS       T01003                                 

Definition
(RefSeq) hypothetical protein LOC502176
  KO
K02947  small subunit ribosomal protein S10e
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03010  Ribosome
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    502176
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    502176
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    502176
Ribosome [BR:rno03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    502176
SSDB
Motif
Pfam: S10_plectin
Other DBs
NCBI-GeneID: 502176
NCBI-ProteinID: NP_001020228
RGD: 1560919
Ensembl: ENSRNOG00000030321
UniProt: Q7TP86
Position
18q12.1
AA seq 151 aa
MEVCQHLRHQCVNIGRRSAGLKENTYMGHPFSASATKALLRSPYIPDAKAVENNKAGFTA
EWYDRLPFSIAVQTQKDKHHVLFLISSASDPAAVAMLMPKKNRIAIYELLFKEGVMVAKK
DVHMPKHPELADKNVPNLHVTKATQSLESRG
NT seq 456 nt   +upstreamnt  +downstreamnt
atggaggtctgccagcacctgcgccaccagtgtgtgaatatcgggcgtaggtctgcggga
ttgaaagaaaacacatacatgggtcacccgttttcagcgagtgccaccaaggctttactg
agatctccttatataccagacgcaaaagccgtggaaaacaacaaggcaggctttacagct
gagtggtatgatcgattgcctttctccattgcggtgcagacccagaaagacaaacaccac
gtgctttttcttatttcctccgcctcggaccctgcagccgtcgccatgttgatgcccaag
aagaaccggatcgccatctatgaactcctttttaaggaaggggtgatggttgccaaaaaa
gacgtccacatgcccaaacaccccgagctggcagacaagaacgtgcccaaccttcacgtc
acgaaggccacgcagtctctcgagtctcgaggctaa

DBGET integrated database retrieval system