KEGG   Rattus norvegicus (rat): 502208
Entry
502208            CDS       T01003                                 

Gene name
Slc38a8, RGD1560237
Definition
(RefSeq) solute carrier family 38, member 8
  KO
K14994  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 7/8
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    502208 (Slc38a8)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   502208 (Slc38a8)
SSDB
Motif
Pfam: Aa_trans Trp_Tyr_perm
Other DBs
NCBI-GeneID: 502208
NCBI-ProteinID: NP_001178938
RGD: 1560237
Ensembl: ENSRNOG00000025503
UniProt: D4A0Y7
Position
19q12
AA seq 432 aa
MEGQTRGSRGLPEKPLPATTHPPLSSLGAVFILLKSALGAGLLNFPWAFYKAGGLVPTFL
VALVSLVFLISGLVILGYAASVSGQTTYQGVVRELCGPAMGKLCEACFLTNLLMISVAFL
RVIGDQLEKLCDSLLPDAPQPWYAAQSFTLPLISVLVIFPLSALRDIALQEYTSILGTLA
ACYLALVITVQYYLWPQGLIRQPGPLLSPSPWTSVFSVFPTICFGFQCHEAAVSIYCSMQ
NQSLPHWTLVSVLSLMACCLVYTLTGVYGFLTFGTEVSADILMSYPGNDTAIIVARVLFA
VSIVTVYPIVLFLGRSVMQDFWKKSYWATQGSPVLADPSGPWVRLPLTFLWVAVTLAMAL
FLPDLSEIIGVIGGLSAFFIFIFPGLCLISAVDTEPIGPRVKCCLEAWGTLSVLLGTFVF
GQSTAGALVELL
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggaagggcagaccagagggagcagaggccttccggagaagcccctccctgctaccacc
catccccctctgtcctcactgggcgccgtgttcatcctcctgaagtccgcactgggagct
ggcctgctcaacttcccctgggccttctacaaggcaggaggcctggtgcccaccttcctg
gtggcactggtatccttggtcttcctgatcagcggtctggtcatcctgggctatgcagca
tctgtcagtggccagaccacctaccagggtgtggtccgtgagttatgtggccccgccatg
gggaagctgtgtgaggcttgcttcctgaccaacctgctcatgatctccgtagccttcctc
agagtgatcggggaccaactggaaaagttgtgtgactccctcctgcctgacgccccacag
ccctggtacgcagcccaaagcttcaccctgcccctgatctccgtgctggtcatcttcccc
ctgtcagcacttcgggacatcgccctccaggagtacaccagcatcctaggtactctggct
gcctgctaccttgctctggtcatcactgtgcagtactacttatggccccagggccttata
cgacagcccggtcctttgctgagcccatctccctggacctctgtgtttagtgtcttccct
accatctgctttggattccagtgtcatgaggccgcggtctccatctactgcagcatgcag
aaccagagcctcccccactggaccttggtttctgtgttgtccttaatggcctgctgcctt
gtctacacgctgacaggggtttatggcttcctgaccttcgggacggaagtttctgctgat
atcttaatgtcctacccaggcaatgacacagccatcattgtagctcgggttctctttgct
gtctccattgtgaccgtctaccccatcgtgctgttcctggggaggtctgtgatgcaggac
ttttggaaaaagagctactgggccacacaggggtccccagtgctggctgacccctcaggg
ccttgggttcggctgccactgaccttcctgtgggtggcagtgacgctcgccatggctctg
ttcctaccggacctcagcgagatcattggcgtcatcggtggcctcagcgccttcttcatc
ttcatcttcccaggtttgtgcctcatctctgctgtggacacggagcccataggaccaaga
gtcaagtgctgcctggaggcctggggcaccctctctgtgctgctgggcaccttcgtcttt
gggcagagcacagctggggccttggtggagctgctctga

DBGET integrated database retrieval system