KEGG   Rattus norvegicus (rat): 502227
Entry
502227            CDS       T01003                                 

Gene name
Gtf2h5, RGD1560991
Definition
(RefSeq) general transcription factor IIH subunit 5
  KO
K10845  TFIIH basal transcription factor complex TTD-A subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03022  Basal transcription factors
rno03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    502227 (Gtf2h5)
  09124 Replication and repair
   03420 Nucleotide excision repair
    502227 (Gtf2h5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    502227 (Gtf2h5)
   03400 DNA repair and recombination proteins [BR:rno03400]
    502227 (Gtf2h5)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     502227 (Gtf2h5)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     502227 (Gtf2h5)
SSDB
Motif
Pfam: Tfb5
Other DBs
NCBI-GeneID: 502227
NCBI-ProteinID: NP_001119560
RGD: 1560991
Ensembl: ENSRNOG00000018007
UniProt: D3ZEI7
Position
1q11
AA seq 71 aa
MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGEL
MDQNAFSLTQK
NT seq 216 nt   +upstreamnt  +downstreamnt
atggtcaacgtcttgaaaggagtgcttatagaatgcgatcccgccatgaagcagtttttg
ctgtacttggatgagtccaatgccttggggaagaagttcatcattcaagacattgatgac
acacatgtctttgtcattgcggaactggttaatgttctccaggagcgagtaggggaactg
atggaccagaatgccttttctcttacccagaagtga

DBGET integrated database retrieval system