KEGG   Rattus norvegicus (rat): 502374
Entry
502374            CDS       T01003                                 

Gene name
Polr2l
Definition
(RefSeq) DNA-directed RNA polymerases I, II, and III subunit RPABC5
  KO
K03007  DNA-directed RNA polymerases I, II, and III subunit RPABC5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    502374 (Polr2l)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    502374 (Polr2l)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    502374 (Polr2l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    502374 (Polr2l)
   03400 DNA repair and recombination proteins [BR:rno03400]
    502374 (Polr2l)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     502374 (Polr2l)
  RNA polymerase III system
   RNA polymerase III
     502374 (Polr2l)
  RNA polymerase I system
   RNA polymerase I
     502374 (Polr2l)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      502374 (Polr2l)
SSDB
Motif
Pfam: RNA_pol_N
Other DBs
NCBI-GeneID: 502374
NCBI-ProteinID: NP_001137383
RGD: 1566209
Position
1
AA seq 67 aa
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK
NT seq 204 nt   +upstreamnt  +downstreamnt
atgatcatcccagttcgctgcttcacctgcgggaagatcgtcggtaacaaatgggaagcc
tacctgggtctgctacaggcagagtacaccgagggggatgccctggacgctctgggcctg
aagcgttactgctgccgccgcatgctgctcgcacacgtggacctgattgagaaactgctg
aactatgcacccctagagaagtga

KEGG   Rattus norvegicus (rat): 681193
Entry
681193            CDS       T01003                                 

Definition
(RefSeq) DNA-directed RNA polymerases I, II, and III subunit RPABC5-like
  KO
K03007  DNA-directed RNA polymerases I, II, and III subunit RPABC5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    681193
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    681193
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    681193
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    681193
   03400 DNA repair and recombination proteins [BR:rno03400]
    681193
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     681193
  RNA polymerase III system
   RNA polymerase III
     681193
  RNA polymerase I system
   RNA polymerase I
     681193
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      681193
SSDB
Motif
Pfam: RNA_pol_N Chordopox_RPO7
Other DBs
NCBI-GeneID: 681193
NCBI-ProteinID: XP_038964475
RGD: 1583498
Position
4
AA seq 67 aa
MIIPVCCFTCGKIIGNKWEAYLGLLQAMYTEGDALDTLDLKRYCCRCMLLAHADLIEKLL
NYALLEK
NT seq 204 nt   +upstreamnt  +downstreamnt
atgatcatcccagtttgctgcttcacctgcgggaagatcattggtaacaaatgggaagcc
tatctgggtctgctgcaggccatgtacaccgagggggatgccctggacactctggacctg
aagcgctactgctgccgctgcatgctgctcgcacacgcggacctgattgagaaactgctg
aactatgcactcctagagaagtga

DBGET integrated database retrieval system