KEGG   Rattus norvegicus (rat): 502389Help
Entry
502389            CDS       T01003                                 

Gene name
Npm3, RGD1565542
Definition
(RefSeq) nucleophosmin/nucleoplasmin, 3
  KO
K11278  nucleophosmin 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    502389 (Npm3)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histone chaperones
    Nucleoplasmins
     502389 (Npm3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleoplasmin Nitrophorin Cadherin_3
Motif
Other DBs
NCBI-GeneID: 502389
NCBI-ProteinID: XP_001058548
RGD: 1565542
Ensembl: ENSRNOG00000017622
UniProt: D3ZYK9
Position
1q54
AA seq 173 aa AA seqDB search
MAAGAAAALAFLNQESRARARGLGGLRVPAPVTMDSFFFGCELSSHTRSFTFKVEEEDDT
EHVLALNMLCLTEGAKDECNVVEVVARDHDNQEIAVPVANLRLSCQPMLSVDDFQLQPPV
TFRLKSGSGPVRITGRHQIVCINNDLSEESPDESEDEIKLCGILPAKKHRGRP
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggccgccggcgccgcggctgctttggcgttcttgaaccaagagagccgagccagggct
cggggcctcgggggcctgagggttccggctccggtcacaatggatagtttcttcttcggt
tgtgagctctccagccacacccgctcctttactttcaaggttgaggaagaggatgataca
gaacatgtgctggctttgaacatgctgtgccttaccgagggtgccaaggacgagtgtaat
gtggtggaagttgtggcccgcgatcacgacaatcaggagattgcagttcctgtggccaac
ctcaggttgtcttgccagcccatgctcagtgtagatgacttccagctccaaccacctgta
acgttccgcctcaagtccggttctggccctgtgcggatcactggtcggcatcagatcgtt
tgtataaacaacgatctttctgaagaaagtccggatgagagtgaagatgaaattaagctg
tgtggaatccttcctgccaaaaagcataggggcaggccttag

DBGET integrated database retrieval system