KEGG   Rattus norvegicus (rat): 502479
Entry
502479            CDS       T01003                                 

Gene name
Lace1
Definition
(RefSeq) lactation elevated 1
  KO
K18798  peroxisome-assembly ATPase [EC:3.6.4.7]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    502479 (Lace1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.7  peroxisome-assembly ATPase
     502479 (Lace1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    502479 (Lace1)
SSDB
Motif
Pfam: AFG1_ATPase AAA UvrD-helicase AAA_16 Bac_DnaA AAA_22
Other DBs
NCBI-GeneID: 502479
NCBI-ProteinID: NP_001032745
RGD: 1561501
UniProt: Q32PX9
Position
20q13
AA seq 480 aa
MAASWSPLVTLRSAARSRLTGRGVGCGARVIAIFPPAPGPRKPLWKAYTVQTLEGVRPTA
ASEAHSRALAVCHGPLAHYDFLIKAQELKNDEHQRRVVQCLQKLQEDLKGYNIEEGGLFS
KLFSRNKPPKGLYVYGDVGTGKTMVMDMFYEYVEVKSKRRVHFHGFMLDVHKRIHRLKQS
LPKRKVGFMAKSYDPIAPIAEEISQEASLLCFDEFQVTDIADAMILKQLFENLFKNGVVV
VATSNRPPEDLYKNGLQRANFVPFIAVLKEYCNTVQLDSGVDYRKRELTPAGKLYYLTSE
ADVGTVMDKLFDELAQKQNDLTSPRILKVQGRELRLNKACGTVADCTFEELCERPLGASD
YLELSKNFDTVIIRNIPQFSLAKRTQVRRFITLIDNFYDFKVRIICSASVPISSLFVYQH
QDSESDQSRVLMDDLGLSQDSAGLSMFTGEEEIFSFQRTLSRLTEMQTEQYWIEGDRSRK
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggcggcctcctggtcgcccttggttaccctgcgctccgcggcgcgtagccggctgact
gggagaggtgttgggtgcggggcgcgggtcatcgcaatctttcctccggcccctggccct
aggaaacccctttggaaagcctacacagtccagacattggagggtgtgcgcccaacagcc
gcttccgaggcccattcgagagctttggctgtttgccacgggcctctggcccactacgac
tttctgatcaaagctcaggagctgaagaacgatgaacatcaaagaagagtcgttcagtgt
ttgcagaagttacaggaggaccttaaaggatacaacatagaggaaggagggctcttttca
aagctcttttcaaggaacaaacctccaaagggcctgtatgtttatggagacgttggtacg
gggaaaacaatggtgatggacatgttttatgagtatgtggaagtgaagagcaaaaggcgg
gtccattttcacggcttcatgctagatgtgcacaaaaggatacaccgccttaaacagagt
ttgccgaaaaggaaggtgggattcatggctaagtcgtacgacccgatagcgcccatagcg
gaggaaatcagccaagaggctagtctcctgtgttttgatgaatttcaggtcactgacatc
gctgacgccatgattctgaaacagctttttgaaaatctgttcaaaaacggggtcgtcgtt
gtggcaacgtccaacagaccaccggaagatctctataaaaacggactccagagggctaac
tttgtgccatttatagctgtcctgaaggaatattgcaatacggtccagctggattctggg
gtagattatcggaaaagggaactcacccctgccgggaaactctactacctcacaagcgag
gctgatgtggggactgtcatggataagttgtttgatgagctggctcagaaacaaaacgat
ctaactagcccaaggattctgaaagtgcaaggcagagagctgcggctgaataaagcctgt
ggaaccgtcgccgactgcacgtttgaggagctgtgtgagagaccactcggagcaagtgac
tatttggaattatccaagaattttgatacggtaatcatacggaacattccacagttttct
ctggcaaagaggacgcaagtgcgcagattcatcactctcattgacaacttctacgacttc
aaggtgcgtatcatctgcagcgcctcggtccccatctccagcctgtttgtgtatcagcat
caggacagcgagtcggaccaaagtcgggtgctgatggatgacttggggctgagccaggac
tcagcgggactctccatgtttaccggggaggaggaaatcttctcctttcaacgcactctt
tcccgcctcacagagatgcagaccgagcagtactggattgaaggggacagaagcaggaag
taa

DBGET integrated database retrieval system